KEGG   Myotis brandtii (Brandt's bat): 102257201Help
Entry
102257201         CDS       T02920                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102257201 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGAEEPVYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTDRQLRYKEKVAELRKKRNSGLSKEQKEKYLEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagcgatggcacatctcggagatctgcc
cgagtcacccgctcctcagcccggctgagccagagttcccaagattccagccctgttcga
aatttgcagtcttttggcgctgaggagcctgtttattctaccaggagagtgacccgcagt
cagcagcagcccaccccagtgactccgaaaaaatacccacttcggcagactcgttcgtct
ggctcagaaactgagcaagtggttgacttttcagatagagaaactaaaaatacagctgat
catgatgagtctccacctcgaacaccaactggaaacgcaccttcttctgagtctgacata
gatatctccagccccaacgtgtctcatgatgagagcattgccaaggacatgtccctgaaa
gactcgggcagcgacctctctcatcgccccaagcgccgtcgcttccatgaaagctataac
tttaacatgaagtgtcctacaccaggctgtaactctctaggacatcttacaggaaaacat
gagagacatttttccatctcaggatgcccgctttatcacaacctctcagctgacgagtgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtcccacaggcaa
gatgacaacaacaggcatgcaaccaggcatcaggcaccaacagacaggcagctgcgatat
aaggaaaaggttgctgaactcaggaagaaaagaaattccgggctgagcaaagaacagaaa
gagaaatacttggaacacaggcagacctacgggaacacgcgggaacctctcttggaaaac
ctgacgagcgagtatgacttagatcttttccgaagagcacaagcccgggcttcagaggac
ttggagaagttaaggctgcaaggccaaatcacagaggggagcaacatgattaaaacaata
gcttttggtcgctatgagcttgatacttggtaccattctccctatcctgaagaatatgca
cgactcggacggctctatatgtgtgaattctgtttaaagtacatgaagagccaaacgata
ctccgccgacacatggccaagtgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatatccgtgtttgaagtggatggcaagaaaaacaagatctattgccaaaac
ctgtgcctgttggccaagcttttcctggaccacaaaacattatattatgatgtggagccc
ttcctgttctatgtcatgacagaagcggacaacactggctgtcacctgattgggtatttt
tccaaggagaagaattcattcctcaactacaatgtatcctgtatccttactatgcctcag
tacatgaggcagggctatggcaagatgctcattgatttcagttatttgctttccaaagtg
gaagaaaaagttggctccccagaacgtcccctctcagatctggggctcataagctatcgc
agttactggaaagaagtgcttcttcgttacctgcataatttccaaggcaaagagatttct
atcaaagaaattagccaggagacagctgtgaatcctgtggacattgtcagcactctgcaa
gcccttcagatgctcaagtattggaaaggaaaacacctagttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaagcgatccaattccaataaaaccatggatccc
agctgtttaaaatggacccctcccaagggcacttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system