KEGG   Myotis brandtii (Brandt's bat): 102257440Help
Entry
102257440         CDS       T02920                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:myb00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102257440 (LYZ)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102257440 (LYZ)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102257440 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 124 aa AA seqDB search
MKALLTLGLLLLSVAVQAKVYERCELARTLKRRYSGSLANWMCLAKWESSYNTRATKYNP
GDKSTDYAIFQINSHYWCNEGKTPGGVNGCGIPCNVLLQDDITQAVTCAKRVVRDPQGIR
AWYV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctgactctggggctgctcctcctctctgtcgccgtccaggccaaggtc
tatgagaggtgtgagctggccagaaccttgaaaagacgctacagtgggagcctggcaaac
tggatgtgtttggccaaatgggaaagtagttacaacacacgagctacaaagtacaatcct
ggagacaaaagcacggattatgcgatattccagatcaatagccactactggtgtaatgag
ggcaaaaccccaggaggagttaatggctgtggtataccctgcaacgttttgcttcaagat
gacatcactcaagctgtaacctgtgccaagagggttgtcagggatccacaaggcatcaga
gcatggtatgtgtaa

DBGET integrated database retrieval system