KEGG   Myotis brandtii (Brandt's bat): 102257744Help
Entry
102257744         CDS       T02920                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102257744 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102257744 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102257744 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    102257744 (KAT2A)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102257744 (KAT2A)
Transcription machinery [BR:myb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102257744 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 800 aa AA seqDB search
MCGQPTRPQSPGLHFTCGAWEEGRAPKSPHQNPKRTAILTALEAFKREEHEALAGERLLV
RPWDTDRLFDGSFCLQANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADH
VSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVV
EGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFR
QRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKF
RVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPAAVS
AAVVPSAPIFSPTMGGGSNSSLSLDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPME
LVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVL
LWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIV
FCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSR
YLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFK
EGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPV
KKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRC
ASALEKFFYFKLKEGGLIDK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggcagccaactcgacctcagtccccgggcctgcacttcacctgcggggcttgg
gaggagggcagagcccccaagtctccccaccagaaccccaagaggacagcgatcttgacc
gccctggaagccttcaagagagaggaacacgaagctctggctggggagaggctcctcgtc
cgtccctgggatacagacaggctttttgacggatccttctgcctccaggccaatgagacc
tgcaagtgtaatggctggaaaaaccccaagccccccaccgcaccccgcatggacctgcag
cagccagctgccaacctgagtgagctgtgccgcagctgtgagcaccccttggcggaccat
gtgtcccacctggagaatgtgtcagaggaggagattaaccggctgctggggatggtggtg
gatgtggagaatctgttcatgtctgttcacaaggaggaagacacagacaccaagcaggtc
tatttctacctcttcaagctccttcggaaatgcatcctgcagatgacccggccggtggtg
gaggggtctttgggcagccccccatttgagaagcctaatattgagcagggtgtgctaaac
tttgtgcagtacaagttcagtcatctggctccccgggagcggcagacaatgttcgagctc
tcgaagatgttcttgctctgccttaactactggaagcttgagacacctgctcaatttcgg
cagaggtctcaggctgaggacgtggctacctacaaggtcaattacaccagatggctctgt
tactgccacgtgccccagagctgcgatagcctcccccgctacgagaccactcacgtcttt
gggcgaagcctgcttcgctccatcttcaccgtcacccggcggcagctgctagagaagttt
cgggtggagaaggacaagctggtgcccgagaaaaggaccctcatcctcacccacttcccc
aaattcctgtccatgctggaggaggagatctacggggcaaactctccgatctgggagtca
ggcttcaccatgccaccctcggaggggacccagctggtgccccggccagctgcagtcagt
gcagccgtcgttcccagcgcccccatcttcagccccaccatgggtgggggcagcaatagc
tccttgagtctggattctggaggtgctgagcccatgccaggtgagaagaggaagctccca
gagaacctgaccctggaggacgccaagcggctccgtgtgatgggcgacatccccatggag
ctggtcaacgaggtcatgctcaccatcactgaccctgctgccatgctggggcccgagacg
agcctcctgtcagccaatgcagcccgggacgagacagcccgcctggaggagcgccgcggc
atcatcgaattccacgtcatcggcaactcgctgacacccaaggccaaccggcgggtgttg
ctctggctcgtggggctgcagaatgtcttctcccatcagctgccacgcatgcccaaggag
tatatcgcccgcctcgtcttcgacccgaagcacaagactctggccctgatcaaggacggg
cgcgtcatcggtgggatctgcttccgcatgtttcccacccagggcttcacggagattgtc
ttctgtgctgtcacctcaaatgagcaggtcaagggctatgggactcacctgatgaaccac
ctgaaggagtatcacatcaaacacaacatcctctacttcctcacgtacgctgacgagtat
gccatcggctacttcaaaaagcagggcttctccaaggatatcaaggtgcccaagagccgc
tacctgggttacatcaaggactacgagggggcgacactgatggagtgtgagctgaacccc
cgcatcccctacacggagctctcccacatcatcaagaagcagaaggagatcatcaagaag
ctgattgagcgcaaacaggcccagatccgaaaggtctaccccgggctcagctgcttcaag
gaaggtgtgaggcagattcctgtggagagtgtccctggcattcgagagacgggctggaaa
ccactggggaaggagaaggggaaggagctgaaggaccctgaccagctctacacaaccctc
aaaaacctgctggcccagatcaagtcacaccccagtgcctggcccttcatggagcctgtg
aagaagtcagaggcccctgactactatgaggtcatccgcttccccattgacctgaagacc
atgacggagcggctgcgcagccgctactacgtgacccgaaagctctttgtggctgacctg
cagcgggtcatcgccaactgccgcgagtacaaccccccagacagcgagtactgccgctgc
gccagtgccctggagaagttcttctactttaagctcaaggagggagggctcattgacaag
tag

DBGET integrated database retrieval system