KEGG   Myotis brandtii (Brandt's bat): 102258473Help
Entry
102258473         CDS       T02920                                 

Gene name
MGEA5
Definition
(RefSeq) meningioma expressed antigen 5 (hyaluronidase)
  KO
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:myb00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102258473 (MGEA5)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102258473 (MGEA5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     102258473 (MGEA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 842 aa AA seqDB search
MEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFI
YAISPGLDITFSNPKEISTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHA
QVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKV
VSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNP
NCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEDIETDVLY
SPQMALKLALTEWLQDFGVPHQYSSRQVAHSGAKASVVDGTPLVTAPSLNATTVVTTVYQ
EPIMSQGAALSGEPTVLTKEEEKKQSDEEPMDMVVEKQEETDHKNDNQILTEIVEAKMAE
ELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQINKEQFVPAPNEKPLYTVEPVT
LEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKF
EEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIG
DQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPYFPKDEASVYKICRE
MYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYALGTVDVTPFIKKCK
ISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFPSLIKVDIHKKVTDP
SVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGR
SL
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagaaaagaactctttagaaggctccagaaatgggaattaaatacatacctg
tatgccccaaaagatgactacaaacataggatgttttggcgagagatgtattcagtggag
gaagctgaacaacttatgactctcatctctgctgcacgggaatatgagatagagttcatc
tatgctatctcacctggattggatattaccttttctaatcccaaggaaatatctacattg
aaacgcaaacttgaccaggtttctcagtttgggtgcaggtcatttgccttgctttttgat
gatattgaccataatatgtgtgcagcagataaagaggtattcagttctttcgctcacgct
caggtctccatcacaaatgaaatttatcagtacctaggagagccagaaactttcctcttc
tgtcccacagaatattgtggcactttctgttatccaaatgtgtctcagtctccttattta
aggactgtgggtgaaaagcttctacctggaattgaggtgctttggacaggtcccaaagtt
gtttctaaagaaattccagtagagtccatcgaagaggtttctaagattattaagagagct
cctgtaatctgggataacattcatgctaatgattacgatcagaagagactatttctgggc
ccatacaaaggaagatccacagaactcatcccacggttaaaaggagtcctgactaatcca
aattgcgaatttgaagccaactatgttgctatccatacccttgccacctggtacaaatca
aacatgaatggagtgagaaaagatgtagtgatgactgacagtgaagacagtactgtatca
atccaaataaagttagaaaatgaaggcagtgatgaagatattgaaactgatgtactttat
agtccacagatggctctaaagttagctttaacagaatggttgcaggattttggagtacct
catcaatacagcagtaggcaagttgcacatagtggagctaaagcaagtgtagttgatggg
actcccctagttacggcgccctctttaaatgccacaactgtagttacaacggtttaccag
gagcccattatgagtcagggagcagccttgagtggtgaacctacagttctgaccaaggaa
gaagaaaagaaacagtcagatgaggaacccatggacatggtagtggaaaaacaagaagaa
acagaccacaagaatgacaatcaaatattaactgaaattgtagaagctaaaatggcagag
gaattgaaaccaatggacactgataaagagagcatagctgaatcaaaatccccagagatg
tctatgcaggaagactgcatcagtgatattgcccctatgcagactgatgaacagataaac
aaggagcagtttgtgccagctccaaatgaaaagcctttgtacactgtagaaccagtgact
ctggaggatttgcagttacttgctgatctattctacctaccttatgagcatggacccaaa
ggagcacagatgttacgcgagttccagtggcttcgagcaaatagcagtgttgtcagtgtc
aattgtaaaggaaaagactctgaaaaaattgaagaatggcggtcacgagcggccaagttt
gaagaaatgtgtggactagtgatgggaatgttcactcggctttccaattgtgccaacagg
acaatcctttatgacatgtactcctatgtttgggatatcaagagtataatgtctatggtg
aagtcttttgtacagtggttagggtgtcgtagtcattcttcagcacagttcttaattgga
gaccaagaaccctgggcctttagaggcggtctagcaggagagttccagcgtttgctgcca
attgatggggcaaatgatctcttttttcaaccacccccactgactcctacctccaaagtt
tatactatcagaccatattttcctaaagatgaggcttccgtgtacaagatttgcagagaa
atgtatgacgatggagtgggtttaccttttcaaagtcagcctgaccttattggagacaag
ttagtaggagggctgctttccctcagcctggattattgctttgtcctagaagatgaagat
ggcatatgtggttatgccctgggcactgtagatgtgactcccttcattaaaaaatgtaaa
atttcctggattcccttcatgcaagagaagtataccaaaccaaatggtgacaaagaactc
tctgaggcggagaaaataatgttgagtttccatgaagagcaggaagtgttgccagaaact
tttcttgccaacttcccttctctgataaaggtggatattcataaaaaagtaactgaccca
agtgtagccaaaagcatgatggcttgcctcctatcttcactgaaggctaatggctcccgg
ggggctttctgtgaagtgagaccagatgataaaagaattctggaattttacagcaagtta
ggctgttttgaaattgcaaaaatggaaggatttccaaaggatgtggttatacttggtcga
agcctgtga

DBGET integrated database retrieval system