KEGG   Myotis brandtii (Brandt's bat): 102259501Help
Entry
102259501         CDS       T02920                                 

Gene name
ART1
Definition
(RefSeq) ADP-ribosyltransferase 1
  KO
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102259501 (ART1)
Cellular antigens [BR:myb04090]
 Proteins
  102259501 (ART1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:myb00537]
 Enzymes
  102259501 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MQTPATMSLLLVSIVLMEALQSHPITRRGLFSQERPLDMAPTSFDDQYAGCAAAMTAALP
DLNRTEFQANKVYADSWVLASSQWQERKAWGPEWGLSHTLMSPPPPGFRDEHGVALLAYT
ANTPLHKEFNAALREAGRTRIHYLQHFSFKTFHFLLTEALQLLSRAQRSPQCRQVFRGVQ
GLRFQPAGPGVTIRLGGFASASLKNATAQHFGEETFFGIWTCLGVPIRGYSFFPEEEEVL
IPPFETFQVINSSRPAQGPTRIYLRALGKHSVYNCEYIKDKQCKSRSCRLENSAMGQGPL
STVWSLPLLLWFLVGGVFPESPGLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcagactcctgctacgatgtctctgctgcttgtgtccatagtcctcatggaagcactt
cagagccaccccatcacccgacgaggactcttctctcaagaaaggcccctggacatggcc
ccaacctccttcgatgaccagtatgctggctgtgcagcagccatgacagctgctctccca
gatctcaaccgcacggagttccaggccaacaaagtgtatgctgacagctgggtgctggcc
agcagccaatggcaggagcgcaaagcttgggggccagagtggggcctcagccacaccctg
atgtccccaccaccccccggcttccgtgatgagcatggggtggccctcctggcctacacg
gccaacacccccctgcacaaggagttcaatgcggccctgcgcgaggcaggccgcacccgc
atccactacctccagcacttctccttcaagacattccatttcctgctgaccgaggccctg
cagctgctgagcagggcccagcgttctccccagtgccgccaggtgttccgaggggtgcaa
ggcctgcgcttccagccagcagggcctggagtcaccatccggctggggggctttgcctcg
gcgtccctgaagaacgccacagcccagcatttcggcgaggaaaccttctttggcatctgg
acctgccttggtgtccctatcaggggctactccttcttccctgaggaggaggaggtgcta
atccccccctttgagaccttccaggtgatcaacagcagcagacctgcccagggccccacc
cgcatctacctccgggccctgggcaagcacagcgtgtacaactgcgagtacatcaaagac
aagcagtgcaagtctaggtcctgccgactagaaaactcagccatgggtcagggccctctg
tctacagtctggtcccttcctctgctcctctggttcctggtcgggggagtcttcccagag
agtccaggcctcctctga

DBGET integrated database retrieval system