KEGG   Myotis brandtii (Brandt's bat): 102261340Help
Entry
102261340         CDS       T02920                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102261340 (POMT2)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102261340 (POMT2)
Glycosyltransferases [BR:myb01003]
 O-Glycan biosynthesis
  O-linked Man type
   102261340 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 715 aa AA seqDB search
MPSAVCGGLAGSELRPRRGRCGGVLLALVTLLAFATRFHRLDQPPHVCWDETHFGKMGSY
YINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFMFQKPGDRYEHHNYMGMRGFCAFLGSLL
IPFAYLTVLELSKSLPAALLSAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNS
CADRPFSAPWWFWLSLTGINLAGAIGVKFVGLFIILHVGWNTVSDLWHLFGDLSLSLVTV
GKHLTARILCLIVLPLALYTAIYAVHFAVLNQSGPGDGFFSSAFQARLSGNTLHNASVPE
YLAFGSVITVKNLRMAIGYLHSHRHLYPEGIGAHQQQVTTYLHKDYNNLWIIKKQNTDSD
PLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWR
IEVINRKFGNRIKVLRSRIRFIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSI
WNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNNGLKPKDNEFTSKPWHWPVNYQ
GLRFSGINDTDFRVYLLGNPVVWWLNLLSIALYVLSGSIIAVAVQRGAHLPREVEGLSQV
LLRGGGQLLLGWALHYFPFFLMGRVLYFHHYFPAMLFSSMLTGILWDTLLRLCACGLAAS
SLASGVHMGGVLSLLLGTAYSFYLFHPLAYGMVGPLAQDPQSPMAGLRWLESWDF
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggcggtatgcggaggcctggcagggtccgagctacgtccacggaggggccgc
tgtgggggggtcctgctggccctggtgacgctgctggccttcgccacccgcttccatcgt
ctggaccagccacctcacgtctgttgggatgagactcactttggaaaaatgggaagttac
tatatcaaccgtacctttttctttgatgtgcaccctcctctgggaaagatgctgataggt
cttgctggctacctgagtggatatgatggtacctttatgttccagaagcctggggacaga
tatgagcatcacaactacatgggaatgagaggattctgtgcgttcctcggttccttgctg
atcccctttgcctacctcactgtactggagctgtccaagtccctccccgcagcactgctc
agcgctgccctcctcacctttgacacaggatgcctcactctgtcccagtacatcctcctt
gaccccatcttgatgttcttcatcatggctgccatgctgagcatggtcaagtacaactcc
tgtgctgacaggcccttctctgccccctggtggttctggctcagcctgactggcattaat
ctggctggtgctataggggtcaagtttgttggcctctttatcatcctgcacgtggggtgg
aacaccgtatcagacctttggcacctgtttggagacctcagtctttcattggtgactgtg
ggaaaacacctgactgcgcgcatcctgtgcctcatagtgctgccgctggctctctacaca
gccatctatgctgttcacttcgcggtgctgaatcaaagtggtcccggcgatggcttcttc
agctccgccttccaggcccggctctcaggaaacacccttcacaatgcttccgtccctgag
tacctagccttcggctctgtgatcactgtgaagaacctgcggatggccatcggctatctc
cactcccacaggcatctctatcctgagggcattggcgcccaccagcagcaggtcaccacc
tatctgcacaaggactacaacaacctgtggattatcaagaagcagaatacagactcagat
cccctagacccctcattcccagtggagtttgtaagacatggagacatcattcgactagaa
cataaagagacctctcggaacttgcacagtcactatcatgaggcccccctgacccggaag
cactaccaggtcactggctatggcataaatgggacaggggactcaaatgatttctggcgg
attgaggttataaacagaaaatttggaaaccggatcaaagtgctgagaagtcgaattcgc
ttcattcatctggtcacaggctgtgtcctgggctcctcgggaaaggttctgcccaagtgg
ggctgggagcaactggaagttacttgcactccgtacctaaaggaaaccctcaactccatc
tggaatgtggaggaccacatcaatcccaagttgccaaacatcagcctggacgtgctgcag
cccagttttcctgagatcttgctggagtcccacatggtgatgatccgggggaacaatggc
ctcaaacccaaggacaatgaattcacatccaaaccctggcactggcctgtcaactaccag
ggcctgcgcttctcggggatcaatgacacggacttccgagtatacctgctcggcaacccg
gtggtttggtggctgaatctgctgagcattgccctctacgtcctctcagggagcatcatt
gccgtcgctgtgcagagaggggcacatctgcctcgggaggttgaagggctgtcccaggtc
ctgctgcgaggaggcggtcagctgttgctgggctgggcgctccactacttccccttcttc
ctcatgggccgggtcctctatttccaccactacttcccagccatgctcttctccagcatg
ctcacaggcattctgtgggacactctcctgcggctctgtgcctgcggcctggctgcctct
tctctggccagcggtgtccacatggggggagtcctgagcctgctcctgggaactgcctac
agcttctacctcttccatcctctcgcttacgggatggttggtcccctagcccaggacccc
caaagtccgatggcaggactaaggtggctggaatcatgggacttttga

DBGET integrated database retrieval system