KEGG   Myotis brandtii (Brandt's bat): 102262491Help
Entry
102262491         CDS       T02920                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00040  Pentose and glucuronate interconversions
myb00053  Ascorbate and aldarate metabolism
myb00140  Steroid hormone biosynthesis
myb00830  Retinol metabolism
myb00860  Porphyrin and chlorophyll metabolism
myb00980  Metabolism of xenobiotics by cytochrome P450
myb00982  Drug metabolism - cytochrome P450
myb00983  Drug metabolism - other enzymes
myb01100  Metabolic pathways
myb05204  Chemical carcinogenesis
Module
myb_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102262491
   00053 Ascorbate and aldarate metabolism
    102262491
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102262491
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102262491
   00860 Porphyrin and chlorophyll metabolism
    102262491
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102262491
   00982 Drug metabolism - cytochrome P450
    102262491
   00983 Drug metabolism - other enzymes
    102262491
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102262491
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102262491
Glycosyltransferases [BR:myb01003]
 Others
  Hydrophobic molecule
   102262491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 102262491
NCBI-ProteinID: XP_005868962
Position
Un
AA seq 546 aa AA seqDB search
MSHGKGISHLKRSLCATRMPMKWISVLLLLQLSGHFSPGSCGKVLVWPTEYSHWINMKTI
LDALVQRGHEVTVLTSSASILVDPNKPSAIQFEIFPTSLTKDDFEDILMRLTSKWTYMPK
YTFWTYFSLIQDNILEYFDCIQKLCKDAVLNKNLMRKLQESRFDVVLADPSGPCGELLAE
LLKIPFVYSLRFSFGYTIEKYSGGLPFPPSYVPIVLSELSDQMTFMERVKNMMYVLYFDF
WFQAFSEKWDQLYSEALGRPTTLFELMRKAEIWFIRTYWDFEFPRPLLPHFQFVGGLHCK
PAKPLPKEMEEFVQSSGENGIVVFSLSMVVTNMTEERANVIASALAQVPQKVIWRYDSKI
PDTLGPNTQLYKWIPQNDLLGHPKTKAFITHGGANGIYEAIYHGIPMVGLPMFADQPDNI
AHMKTKGAAVRLDFNTISSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRTVFW
IEFVMRHKGAKHLRPAALDLTWVQYHSLDVIGFLLACVATATFVITKCVLFCCRKFLKTG
KKKKRE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggtaaagggatcagccatttgaaaagaagcctgtgtgccaccaggatgcct
atgaagtggatttcagttctgctgctgctacagctgagtggtcacttcagccctgggagt
tgtggaaaggtgctggtgtggcccacagaatacagccattggatcaacatgaagaccatc
ctggatgcacttgtccagagaggtcatgaagtgactgttctgacatcttcagcttcaatt
cttgttgatcccaataaaccatctgctattcaatttgagatttttcctacatctttaaca
aaagatgattttgaggatattctcatgcggctgacctctaagtggacatatatgccaaaa
tatacattttggacttatttttcactaattcaagataacattttggaatattttgattgt
attcaaaagctctgtaaagatgctgttttgaacaagaaccttatgagaaaactacaggaa
tcaaggtttgatgttgttcttgcagatccctctggaccctgtggtgagctgctggctgag
ctacttaaaataccttttgtgtacagtctccgcttctcttttggctatacaattgaaaag
tacagcggaggacttccattccctccatcctacgtacctattgtcttatcagaattaagt
gatcaaatgacattcatggagcgagtaaaaaatatgatgtatgtgctttattttgatttc
tggttccaagcatttagtgagaagtgggatcagctttacagcgaagcactaggaagaccc
actacattattcgagttaatgagaaaagcagaaatatggtttattcgaacctattgggat
tttgagtttcctcgcccactcttgccacattttcaatttgttggaggcctccactgcaaa
cctgctaagcctctgcctaaggaaatggaagagtttgtccagagctctggagaaaatggt
attgtggtgttttccctgtcgatggtggtcactaacatgacagaagaaagagccaatgtg
attgcatcagcccttgcccaggttcctcaaaaggttatatggagatatgatagcaaaata
ccagataccttagggccaaatacccagctctataaatggatcccccagaatgaccttctt
ggtcatccaaaaaccaaagcctttataactcacggtggagccaatggcatctatgaggcg
atctaccatgggatccctatggtgggccttcctatgtttgcggatcaacctgataacatt
gctcacatgaagaccaagggagcagctgtcagattggacttcaacactatttcaagtaca
gatttgctcaatgcattgaagactgtcattaatgaccctttatataaggagaatgctatg
aaattatcaagaattcatcatgaccaaccagtgaaacctctagatcgaacagtcttctgg
atcgagtttgtcatgcgtcacaaaggagccaaacacctgcggccagccgcccttgacctc
acctgggtccagtaccactctttggatgtgattgggttcctgctggcctgtgtggcaact
gctacatttgtcatcacaaaatgtgttctgttttgttgccggaagtttttaaaaacagga
aagaagaaaaaaagagagtag

DBGET integrated database retrieval system