KEGG   Myotis brandtii (Brandt's bat): 102262755Help
Entry
102262755         CDS       T02920                                 

Gene name
GYS1
Definition
glycogen synthase 1 (muscle)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102262755 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102262755 (GYS1)
   04152 AMPK signaling pathway
    102262755 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102262755 (GYS1)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102262755 (GYS1)
Glycosyltransferases [BR:myb01003]
 Polysaccharide
  Storage polysaccharide
   102262755 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 661 aa AA seqDB search
MPLSRTLSVSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFATVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNNSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADTNAKPVPSRLPGLAWATSGQESANTLSWCQG
F
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcactttgtccgtgtcctcgctgccgggactggaagattgggaggat
gaattcgacctggagaacacggtgctcttcgaagtggcctgggaggtggccaacaaagtg
ggcggcatctacacggtgctgcagacgaaggcgaaggtgacaggagatgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gagcccccgaccccggctctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtattttgggcgctggctgatcgaagggggccccctggtggtgctcttggatgtggga
gcttcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgcgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacacgtggtggcacacttccac
gaatggctggcgggggtcgggctctgcctgtgccgggcccggcggctgcctgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggtgccgtggacttc
tacaacaacctagagaacttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcagcccactgcgctcatgtcttcgctactgtgtcccag
atcaccgccatcgaggctcagcaccttctcaagaggaaaccagatatcgtgacccccaac
ggactgaacgtgaagaagttctctgccatgcacgagttccagaacctccatgctcagagc
aaggcccggatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagacgttgtacttcttcatcgccggccgctacgagttctccaacaagggggccgac
atcttcctggaggccttggcccggctcaactatctgctcagagtcaacaacagtgagcag
accgtggtcgccttcttcatcatgcccgcgcggaccaacaacttcaacgtggaaaccctc
aagggccaggcggtgcgcaagcagctttgggatacggccaacacagtgaaggagaaattc
ggaaggaagctttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcaccatgatgaagagagccatctttgccacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggacgactcctcagaccctatcctgaccaccatt
cgccgaattggcctcttcaatagcagcgccgacagggtcaaggttattttccacccggag
ttcctgtcctccaccagccccctgctgcccgtggactacgaggagttcgtccgtggctgc
cacctcggggtcttcccctcctactacgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagcatctccaccaacctctccggcttcggctgcttcatggaggag
cacatcgcagacccctcggcatacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgt
cagcgcatcatccagcggaaccgcaccgagcgcctctccgaccttctggactggaaatac
ttgggccggtactatatgtctgcgcgccacatggccctggccaaggcctttccagagcac
ttcacctacgagccccacgaggctgacacgaatgccaaacctgtgccctcgcgtctccca
ggtctggcctgggccaccagcggccaggaatctgccaataccctgtcatggtgccagggt
ttttag

DBGET integrated database retrieval system