KEGG   Myotis brandtii (Brandt's bat): 102264098Help
Entry
102264098         CDS       T02920                                 

Gene name
CES5A
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102264098 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MSRACRRASQMRGEWVHPGQTLIWAVWVLVAATEGETPSGREGLSEGPAGDGPTRSTRLG
WVRGKQATVLGSTMPVNVFLGVPYAAPPLGSLRFTNPKPASPWNGIRNATSYPNLCFQNS
EWLFSNQHILRVHYPEFGVSEDCLYLNIYAPARADTGSKFPVMVWLPGGAFQTGSASIFD
GSALAAYEDVLVVTTQYRLGMFGFFNTGDKHAPGNWAFMDQLAALTWVQENIEFFGGDPR
SVTIFGESAGAISVSSLILSPLAQDLFHKAIMESGVAILPYLKAPEEKRNEDLQMIANIC
GCRADNSEALLRCLRAKSSQELLGIGQVAKSFTRMVDGFFFPDEPLELLIKKTFRSVPSI
IGVNNHECGFLLPMKEFPEILRGSNKSLALQLLHTILHIPSQHLHFVADEYFHGEQSIFE
IRNNFLDLLGDVFFVVPGLITARCHRDAGAPVYFYEFQHRPHCFKDSKPAFVKADHTDEI
RFVFGGAFLKGDVVMFEGATEEEKLLSRKMMRYWANFARTGNPNGAGLPRWPAYDQKEQY
LQLDLNLSVGQGLRAQKVEFWMETLPLIMATSGGAQLGPLFSFIFLSLLLPFFSSFSHGG
GISV
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggcgtgcaggcgggccagccagatgaggggagagtgggtgcacccaggccag
accctgatctgggctgtttgggtccttgtagctgccaccgagggtgagacacccagtggg
agagaagggctctcagaagggccagctggagatggacccaccaggagcaccaggctgggc
tgggtccgggggaagcaagccactgtgttgggaagcaccatgcctgtgaatgtgttcctc
ggggtcccctacgctgcacccccgctaggatccctgcgatttacaaacccaaagcctgcg
tcgccctggaatggcatccgaaatgccacatcctaccctaatttgtgcttccagaactca
gagtggctgttctcaaatcaacacattctccgggtgcactaccccgaattcggagtgtcg
gaagactgcctgtaccttaacatctatgcaccagcccgtgccgacaccggctccaagttc
ccggtcatggtgtggcttccggggggtgccttccagactggctcagcctccatcttcgat
gggtccgccctcgctgcctacgaggatgtgctggttgtgactacccagtaccggctagga
atgtttggcttcttcaacacaggggacaagcacgcgccggggaactgggccttcatggac
cagctggccgccctgacctgggtccaggagaacatcgagttctttggtggggacccacgc
tccgtgaccatcttcggcgagtcggcgggagccataagtgtgtccagccttatcctgtcc
ccgctggcccaggacttattccacaaagccatcatggagagcggggtggccatcctcccc
tacctgaaggccccggaggaaaagcggaatgaggatttgcagatgattgcaaatatctgc
ggctgcagagcggacaactccgaggccctgctgcggtgcctgagggcaaagtcctcccag
gagctgctgggcatcggccaggtcgccaagtctttcacgagaatggttgatggttttttc
tttcctgacgagcctctagaactgctgattaaaaaaacgttccgctcagttccttctatc
atcggggtcaataaccacgagtgtggcttcctgctgcccatgaaggagtttcctgagatc
ctcaggggctccaacaagtccctcgccctgcagctgctgcacacaatcctgcacatcccc
agccagcatttacacttcgtggcggatgagtatttccacggcgagcagtccatttttgaa
atacgaaataatttcctggacttgcttggagatgtgttctttgtggtccctgggctgatc
acggctcgatgtcacagagacgcgggtgcacctgtgtacttctatgagtttcagcaccgg
cctcactgcttcaaggacagcaagccggctttcgtcaaggccgaccacacggatgaaatc
cgctttgttttcggaggtgccttcctgaagggggatgtcgtcatgtttgaaggagccacc
gaggaggagaagttgctgagcaggaagatgatgagatactgggccaactttgctcggacg
gggaaccctaacggagctggcctgcctcggtggccggcttatgatcagaaggagcagtac
ctgcagctggatttgaacctgagtgtggggcagggattgagagcgcagaaggtggagttt
tggatggaaaccctccctttgatcatggccacttctgggggggcccaactgggtcctctt
ttctccttcatcttcctttctctgcttctgcctttcttttcctctttttctcacggaggg
ggtatctctgtgtga

DBGET integrated database retrieval system