KEGG   Myotis brandtii (Brandt's bat): 102264141Help
Entry
102264141         CDS       T02920                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102264141 (DBH)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102264141 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 594 aa AA seqDB search
TAVAVFLVILVAALQGSTPPESPFPYRIPLDPEGTLELSWNVSYAQETVHFQLLVRELKA
GVLFGMSDRGEMENADLAVLWTNGDRAYFGDAWSDQKGQIHLDAQQDYQLLQAQRTPQGL
TLLFRRPFSTCDPRDYLIEDGTVHLVYGILEQPFSSLEAINTSGLRTGLQRVQLLKPNIS
LPALPADVRTMEVRAPDVLIPGQETTYWCYMTELPAGFPRHHIVMYEPIVTEGNEALVHH
MEVFQCAAGFESFPHFSGPCDSKMKPERLNYCRHVLAAWALGAKAFYYPEEAGLAFGGAG
SSRFLRLEVHYHNPLKIQGRRDSSGIRLYYTATLRRFDAGIMELGLVYTPVMAIPPGEAA
FVLTGYCTDKCPPQALPPSGIHIFASQLHTHLTGRKVVTVLARDGRERAIVNRDNHYSPH
FQEIRMLKKVVSVHPGDVLITSCTYNTEDRTLATVGGFGILEEMCVNYVHYYPQTQLELC
KSAVDAGFLQKYFHLVNRFNSEEVCTCPQTSVPEQFASVPWNSFSRDVLQALYGFAPLSM
HCNKSSAVRFQGEWDLQPLPEIVSQLEAPAPRCPASQGLSPVGPTVVNISGGQG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
acggcggtggccgtgttcctggtcatcctggtggccgcgctgcagggctcgacgcccccc
gagagccccttcccctaccgcatccccctggaccccgaggggaccctggagctctcctgg
aacgtcagctacgcgcaggagaccgtccacttccagctgctggtgcgcgagctcaaggcc
ggggtgctgttcgggatgtcggaccgcggggagatggagaacgccgacctggccgtgctc
tggacgaacggggacagggcctacttcggggacgcctggagtgaccagaagggacagatc
cacctggacgcccagcaggactaccagctgctgcaggcccagaggaccccgcagggcctg
accctgctcttccggcggcccttcagcacctgcgacccccgggactacctcatcgaggac
ggcaccgtccacctggtgtacgggatcctggagcagcccttctcgtcgctggaggccatc
aacacctcgggcctgcgcaccgggctgcagagggtgcagctgctaaaacccaacatctcc
ctcccggccctgcccgcggacgtgcgcaccatggaggtccgcgcccccgacgtcctcatc
cctggccaggagaccacctattggtgctacatgaccgagctccccgccggcttcccccgg
catcacatcgtcatgtacgagcccattgtcaccgagggcaacgaggcgctggtgcaccac
atggaggtgttccagtgcgcggccgggttcgagagcttcccccacttcagcgggccctgc
gactccaagatgaagcccgagcgcctcaactactgccgccacgtgctggccgcctgggcc
ctgggcgccaaggccttttactacccggaggaagcgggccttgctttcgggggtgccggg
tcctccaggtttctccgcctggaagttcactaccacaacccgctcaagatacaaggccgg
cgggactcctcgggcatccgcctgtactacacggctacgctgcggcgcttcgacgcgggc
atcatggagctgggcctggtgtacacgcccgtgatggccatcccccccggggaggcggcc
ttcgtgctcacgggctactgcacggacaagtgccccccgcaggccctgcctccctcgggg
atacacatctttgcctcccagctgcacacgcacctgaccgggcggaaggtggtcaccgtg
ctggcccgggacggccgggagagggccattgtgaacagggacaaccactacagcccccac
ttccaggagatccgcatgctgaagaaggtcgtgtccgtccacccaggcgacgtgctcatc
acttcctgtacgtacaacacggaagacaggacgctggccaccgtgggcggcttcggcatc
ctggaggagatgtgtgtcaactacgtgcactactacccgcagacgcagctggagctgtgc
aagagcgccgtggacgccggcttcctgcagaagtacttccacctcgtcaacaggttcaac
agcgaggaggtgtgcacctgcccccagacctccgtccccgagcagtttgcctccgtcccc
tggaactccttcagccgcgacgtgctccaggccctgtacggcttcgcccccctctccatg
cactgcaacaagtcctcggccgtgcgcttccagggggagtgggacctgcagccgctgccc
gagatcgtctcgcagctggaagcgcccgcccctcggtgcccggccagccagggtctgagc
cctgtcggccccactgtggtcaacatcagtggcggccaaggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system