KEGG   Mycobacterium abscessus 4529: NF90_19130Help
Entry
NF90_19130        CDS       T03535                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
Organism
myc  Mycobacterium abscessus 4529
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3906084..3907238
Genome map
AA seq 384 aa AA seqDB search
MSRGVAVIGVGQSKQAKKREVTIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGV
MNPELYLADAIGARGLPVTRVFTGGSVGGHAAIYAAHLIQARLAGRVLVVAYSKESEGNF
TWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSHAPEHIGWQVAVNHRLNATRNPYAHIH
KPDITIEEVRSSPMLWDPIRFLESCPSSDGSCAVVISSEMHARLAPRPPAWIHGTGWRTE
TGHFAGRDEVNPRAGQECAAAAYREAGITDPGTEVDVSELYIPYSWYEPMWMENIGLAPE
SSGWRAVDEGHTAFGGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQVDGAR
RAIGHAMGGASQFHALWVVGSEKP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcggtgtcgccgtcattggcgtcgggcaaagcaagcaagccaaaaaacgtgag
gtgaccatcgccgcactggtccgcgaagcggtggacggggcgctggccgacgccgagctg
accttcggcgacatagacgcgatcgtgctggccaagactcccgatctattcgacggcgta
atgaacccggagctgtacctcgccgacgcaatcggcgcgcggggtctgccggtcacgcgc
gtattcaccggtggcagcgtcggcggtcacgccgccatctacgccgcgcacctgatccag
gcccggctggccggacgggtattggtggtcgcgtactccaaagagtccgagggcaatttc
acgtgggcactgtcacgtccgttgccattcagtgcccagttgggagccggcgcaggcggc
cacttcgcaccggtgatccgggagtacatccgccgctcgcacgcaccggaacatatcggc
tggcaggtggcggtgaatcatcgcctcaacgccacccggaacccctacgcgcatatccac
aaacccgatatcaccatcgaggaggtgcgcagctccccgatgctgtgggacccgatccga
ttcctggagtcgtgcccgtcctcggatggctcgtgtgccgtcgtgatttcttcggagatg
catgcgcgcctcgctccccgaccgccggcctggattcatggcaccggatggcgcaccgaa
acaggacatttcgcgggccgagacgaagtgaacccgcgtgctggacaggagtgcgccgcc
gccgcgtatcgcgaggcgggcatcaccgatcccggcaccgaagtggatgtctccgagctc
tacattccctacagctggtacgagccgatgtggatggagaacatcggtctggcaccggag
agttcgggctggcgcgccgttgatgagggccacaccgcattcgggggccggcacccgatc
aacccgtccggaggggtgctctccggcaatccgaccggtgccaccggcctactccgattc
gccgaggccgcactgcaggtgcgggggctcgcgggtgaacaccaggtcgatggcgccagg
cgtgcgataggccacgccatgggcggggcgtcacagttccacgcgttgtgggtggtggga
agtgagaaaccatga

DBGET integrated database retrieval system