KEGG   Myotis davidii: 102755037Help
Entry
102755037         CDS       T02992                                 

Gene name
PTGS1
Definition
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
myd  Myotis davidii
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102755037 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102755037 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102755037 (PTGS1)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102755037 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 624 aa AA seqDB search
MNRESRPGATGIPSASGGALNARLSPPLSLPAGWSLSSWFPLLLLLLPAGAREPSPVNPC
CYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPDLWTWLRNSLRPSPSFTHCLLTHG
RWFWELINATFIRDMLMRLVLTARSNLIPSPPTYNVAHDYISWEAFSNLTYYTRVLPSVP
QDCPTPMGTKGKQQLPDPQLLSRRFLLRKKFIPDPQGANLMFAFFAQHFTHQFFKTSGKM
GAGFTKALGHGVDLGHIYGDNLDRQYQLRLFKDGKLKYQMLGGEMYPPSVEEAPVLMHYP
KGIPPKSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLIL
IGETIKIVIEEYVQQLSGYFLQLKFDPELLFSNQFQYQNRIALEFNHLYHWHPLMPDSFT
VGSQDYSYEQFLFNTSMLVDHGVEALVDAFSRQSAGRIGGGRNIDHHILHVAMDVIKESR
EQRLQPFNEYRKRFGMKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNS
IFGESMIEIGAPFSLKGLLGNAICSPEYWKSSTFGGEMGFNIVKTATLKKLVCLNTKTCP
YVSFHVPDPLQDDEPGVERPSTEL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgagtcccgccccggtgccacaggaatcccctctgcctccggcggagccttg
aatgccaggctcagccctccactctctctccctgcaggatggagtctttcgtcctggttc
ccactgctcctgctgctgctgcccgcgggcgccagggagccctcgccggtgaacccctgt
tgctactacccatgccagcaccagggcatctgtgtccgctttggccttgaccgctaccag
tgtgactgcacccgcacgggctattctggccccaactgcaccatccctgacctgtggacc
tggctccggaattcattgcggcccagcccctctttcacccactgcctgctgacacacggg
cgctggttctgggagttaatcaatgccaccttcatccgtgacatgctcatgcgactggta
ctcacagcgcgttccaaccttattcccagcccccctacctacaacgtagcccatgattac
atcagctgggaggccttctccaacttgacctattacactcgtgttctgccctctgtgcct
caagactgccccacacccatggggaccaaaggaaagcagcagctgccagatccccagctc
ctgagccgtcgcttcctgctcaggaagaagttcatacctgacccgcaaggtgccaacctc
atgtttgccttctttgcccaacacttcacccaccagttcttcaaaacttctggcaagatg
ggtgctggcttcaccaaggccttgggccatggggtagaccttggccacatttatggagac
aatctggaccgtcagtatcagctgcggctctttaaggatgggaaactcaagtaccagatg
ctgggcggagagatgtacccgccatcggtggaagaggcgcctgtgttgatgcactaccca
aagggcattccgcccaagagccagatggctgtgggccaggaggtgtttggactgcttccc
ggactcatgctttatgccacgctctggctgcgcgaacacaaccgtgtgtgtgacctgctg
aaggctgagcaccctacctggggagatgaacagctcttccagacggcccgcctcatcctc
ataggggagaccatcaagatcgtcatcgaggagtacgtgcagcagctgagtggctacttc
ctgcagctcaagttcgacccggagctgctgttcagcaaccagttccagtaccagaaccgc
atcgccttggagttcaaccatctctaccactggcacccgctcatgcccgactccttcacg
gtgggctcccaggactacagctatgagcaattcctgtttaacacctccatgctggtggac
catggggtggaggccctggtggacgccttctctcgccagagcgctggccggattggtggg
ggtaggaacatagatcaccatatcctgcatgtggccatggacgtcatcaaggaatctcga
gagcagcggctgcagcctttcaatgagtaccgcaagaggtttggcatgaagccctacacc
tctttccaggagttcacaggagagaaggagatggcagctgaattggaggagctctatgga
gacattgatgccttggagttctacccgggactgcttcttgagaagtgccatccaaactcc
atctttggggagagtatgatagaaattggggctcccttttccctcaagggcctcttaggg
aatgccatctgttctcctgagtactggaagtcaagcacatttggtggtgagatgggcttc
aacattgttaagacggccacactgaagaagctggtttgcctcaacaccaagacgtgtccc
tatgtttccttccatgtacctgatcctctccaggatgatgagcctggtgtggagcggcca
tccacagagctctga

DBGET integrated database retrieval system