KEGG   Myotis davidii: 102755453Help
Entry
102755453         CDS       T02992                                 

Definition
intestinal-type alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
myd  Myotis davidii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102755453
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102755453
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102755453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 531 aa AA seqDB search
MQGAHVLLLLLLGLRIQHSLGFIPAEEEDPAFWNHQAAQALDTAKKLQPIQTAAKNLILF
LGDGMGVSTVTATRILKGQMNGKLGPETPLAMDKFPFVALAKTYNVDRQVPDSAGTATAY
LCGVKTNFLIIGVSAAAQYNQCNTTHGNEVISVMNRAKKAGKSVGVVTSTRVQHASPAGT
YAHTVNRNWYSDADMPAQALKDGCRDISMQLITNMDIDVILGGGRKYMFPKGTPDPEYPG
DASKSGVRLDMRDLVQEWQAKHKGARYVWNRTALIQASQDPSLSHLMGLFEPGDMHYEAN
RDSQQDPSLKEMTEAALRLLRRNPRGFYLFVEGGRIDQGHHAGRAYYALTDAVAFDDAID
RASQLTSEKDTLTLVTADHSHVFTFGGYTLRGSSIFGLAPEKAKDGKAYTSILYGNGPGF
AVSGGSRSDVRDNQSRDPNYRQQAAVPLSSETHAGEDVAVFARGPQAHLMHGVQEQSVVA
HVMAFAACLEPYTACGLTPAEHAEPSAGPWAGPSLVLLTGALLLLLGTIQP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcccatgtgctgctgctgctgctgctgggcctcaggatacagcattccctc
ggattcatcccagctgaggaggaagacccagccttctggaaccaccaggcagcccaggct
ctggacaccgccaagaagctgcagcctatccaaacagccgccaagaacctcattctcttc
ctgggggacgggatgggggtgtccacagtgacagcaactcggatcctaaaggggcagatg
aatggcaaactgggacctgagacccccctggccatggacaaattcccattcgtggctctg
gccaagacttacaacgtggacagacaagtgccagacagtgcaggcacggccacagcctac
ctgtgtggtgtcaagaccaacttcctgatcattggtgtgagtgcagcagcccagtacaac
cagtgcaacacaacacatggcaacgaggtcatctctgtgatgaaccgggccaagaaagca
gggaagtcagtgggggtggtgacctcaacgagggtgcagcatgcctcgccggctggtacc
tacgcgcacacggtgaaccgcaactggtactcagatgcagacatgcctgcccaggcgctg
aaggacggctgtcgggacatctccatgcagctcatcaccaacatggacattgatgtgatc
ctgggtggaggccgcaagtacatgtttcccaaggggaccccagaccctgagtaccctggt
gatgcctcaaagagcggagtcagattggacatgcgggacctggtccaggagtggcaggcc
aagcacaagggtgcccggtatgtgtggaaccgaacagcgctcattcaggcgtcccaggac
ccctccctatcacacctcatgggcctctttgagccaggggacatgcactatgaggccaac
cgagactcccagcaggacccaagcctgaaggagatgacagaggctgccttgcgtctactg
cgcaggaacccccggggcttctacctgttcgtggagggcggccgcattgatcaaggtcat
catgcgggaagagcttactacgcactgacagatgctgttgcttttgatgacgccattgac
agggccagccagctcacaagcgagaaggacaccctgacccttgtcactgctgaccactct
cacgtcttcacttttggtggctacactctgcgtggcagctccattttcgggctggctcct
gagaaggcgaaagatggcaaggcctacacctccatcctttatggcaatggccccggcttc
gcagtcagcgggggctcccggtcagatgtccgtgacaaccagagcagggaccccaactac
aggcagcaggcggccgtgcccctatcgtcggagacccacgctggtgaggacgtggcggtg
ttcgcgcgtggcccgcaggcgcacctgatgcacggtgtgcaggagcagagcgtggtggcg
cacgtcatggccttcgccgcctgcctggagccctacaccgcctgcggcctgacgcctgct
gagcacgcggagccctcagccggcccctgggcaggcccttcactggttttgctgactggg
gcgctgctgctgctactggggaccattcagccctga

DBGET integrated database retrieval system