KEGG   Myotis davidii: 102759722Help
Entry
102759722         CDS       T02992                                 

Gene name
SCD
Definition
(RefSeq) stearoyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
myd  Myotis davidii
Pathway
myd01040  Biosynthesis of unsaturated fatty acids
myd01212  Fatty acid metabolism
myd03320  PPAR signaling pathway
myd04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102759722 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102759722 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102759722 (SCD)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102759722 (SCD)
Lipid biosynthesis proteins [BR:myd01004]
 Desaturase
  First
   102759722 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102759722
NCBI-ProteinID: XP_006756618
UniProt: L5MD32
Position
Un
AA seq 361 aa AA seqDB search
MPAHLLQEEMSSSYTTTTTTTITEPPARIVQNGEGNSEKHLLLAEEDIRPEMKDDIFDPS
YKDKEGPRPKLEYVWRNIILMSLLHLGALYGIVLIPTCKVYTWLWGFFYYIISALGITAG
AHRLWSHRSYKARLPLRVFLIIANTMAFQNDAYEWARDHRVHHKFSETDADPHNARRGFF
FSHVGWLLVRKHPAVKEKGGLLDLSDLKAEKLLMFQRRHYKPAVLLMCFVLPTLVPWYFW
GETFQHSLYVATFLRYAIVLNATWLVNSAAHLYGYRPYDKNINPRENILVSLGAVGEGFH
NYHHSFPYDYSTSEYRWHINLTTFFIDCMAALGLAYDRKKVSKAAVLAKIKRTGDGSYKS
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggaggagatgtctagctcctacaccaccaccaccaccacc
accatcacagagcctcccgccaggatcgtgcagaatggagaaggcaactccgagaagcat
ctcctgctcgcggaggaagacatccgccctgaaatgaaagacgacatcttcgacccaagt
tacaaggataaggagggcccgaggcccaagctggagtatgtgtggcggaacatcatcctt
atgtctctgctacacttgggcgccctgtatgggatcgtactgatccccacctgcaaggtc
tacacctggctctgggggttcttctactacatcatcagtgccctgggtataacagcagga
gcccaccgcctgtggagtcaccggagctacaaagctcggctgcccctgcgggtcttcctg
atcatcgccaacacaatggcattccagaacgatgcttatgaatgggcccgagatcaccgt
gttcaccacaagttttcggagacagatgctgacccccacaacgcccggcgtggcttcttc
ttctcccatgtgggttggctgcttgtgcgcaaacacccagctgtcaaagagaagggtggt
ttgctggacttgtctgacctaaaagccgagaagctgctgatgttccagaggaggcattac
aagcccgctgtcctgctcatgtgcttcgtcctgcccacgcttgtgccctggtatttctgg
ggtgaaactttccagcacagcttgtacgttgccactttcttgcggtacgccatcgtgctc
aacgccacctggctggtgaacagcgctgcccacctctacggatatcgcccttacgacaag
aacattaacccgcgggagaacatcctggtttcactgggagctgtgggtgagggcttccac
aactaccatcactcctttccctatgactactccaccagtgagtaccgctggcacatcaac
ctgaccacgttcttcatcgattgcatggctgcccttggtctggcttacgaccggaagaaa
gtatccaaggcggccgtcttggccaagattaaaagaactggagatggaagctacaagagt
ggctga

DBGET integrated database retrieval system