KEGG   Myotis davidii: 102759852Help
Entry
102759852         CDS       T02992                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
myd  Myotis davidii
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102759852 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102759852 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102759852 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102759852 (LPL)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102759852 (LPL)
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102759852 (LPL)
  Exosomal proteins of breast milk
   102759852 (LPL)
Glycosaminoglycan binding proteins [BR:myd00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102759852 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:myd00537]
 Enzymes
  102759852 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 477 aa AA seqDB search
MESKALLLVALGVWLQSLTASRGGVAADNIIGEKDFTDIESKFALRTPEDTAEDTCHIIP
GVAESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLWRAQ
QHYPVSAGYTKLVGKDVATFINWMAEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNR
ITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGT
FQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFE
KGLCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQT
NQAFEISLYGTVAESENIPFTLPEISTNKTYSFLIYTEVDIGELLMLKLKWNSDSYFSWS
DWWSSPGFAIEKIRVKAGETQKKVIFCSREKVSRLQKGKSPVVFVKCHDKSLNKKSN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcgctgctcctggtggcgctgggcgtctggctccagagtctgaccgcc
tcccgcggaggggtggccgccgacaatattataggagaaaaagattttacagacattgaa
agtaaatttgctctaaggacccctgaagacacagctgaggacacttgccacatcattcct
ggagtggcagagtctgtggctaactgccacttcaaccacagcagcaaaaccttcgtggtg
atccatggctggacggtgacgggaatgtatgagagctgggtgcccaaactcgtggctgcc
ctgtacaagagggagccagactccaacgtcatcgtggtggactggctgtggcgggcccag
cagcactacccagtgtctgcgggctacaccaagctggtggggaaagatgtggccacattt
atcaactggatggcggaggaatttaactaccctctggataatgtccatctcttgggatac
agcctgggggcccacgctgctggtgttgcaggaagtctgaccaataagaaggtcaacaga
attacgggcctagatccagctggacctaactttgaatacgcagaagctccaagtcgcctt
tctcctgatgatgcggattttgtagacgtcttacacacattcaccagagggtcaccgggc
cgaagtattggaatccagaaaccagtagggcatgttgacatttacccgaatggaggcacg
tttcaaccaggctgtaacattggggaagctatccgtgtgattgcagagagaggccttgga
gatgtggaccagctggtgaagtgttcccacgaacgctccattcatctcttcattgactct
ctgctgaatgaggaaaaccccagtaaggcctaccggtgcaattcaaaggaagcctttgag
aaagggctctgcctgagctgcaggaagaaccgttgcaacaacgtgggctatgagatcaac
aaggtcagagccaagagaagcagcaaaatgtacctgaagactcgttctcagatgccttac
aaagtcttccattaccaagtaaagatacatttttctggaactgagagtgacacacagacc
aaccaggccttcgaaatctctctgtatggcactgtggccgagagtgagaacatccccttc
accctgcctgaaatttccacaaataagacgtactctttcctcatttacacggaggtggac
atcggagaactgctgatgttgaagctcaaatggaatagcgactcctacttcagctggtcc
gactggtggagcagccctggctttgccattgagaagatcagagtgaaagcaggggagact
caaaagaaggtgatcttctgttccagggagaaagtgtctcgtctgcagaaaggaaagtca
cctgtggtatttgtgaaatgccacgacaagtctctgaataaaaagtctaactga

DBGET integrated database retrieval system