KEGG   Myotis davidii: 102759852Help
Entry
102759852         CDS       T02992                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
myd  Myotis davidii
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102759852
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102759852
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102759852
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102759852
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102759852
  Exosomal proteins of breast milk
   102759852
Heparan sulfate/heparin binding proteins [BR:myd00536]
 Enzymes (General comment) Variety
  102759852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MESKALLLVALGVWLQSLTASRGGVAADSIGEKDFTDIESKFALRTPEDTAEDTCHIIPG
VAESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLWRAQQ
HYPVSAGYTKLVGKDVATFINWMAEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRI
TGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTF
QPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEK
GLCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQTN
QAFEISLYGTVAESENIPFTLPEISTNKTYSFLIYTEVDIGELLMLKLKWNSDSYFSWSD
WWSSPGFAIEKIRVKAGETQKKVIFCSREKVSRLQKGKSPVVFVKCHDKSLNKKSN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcgctgctcctggtggcgctgggcgtctggctccagagtctgaccgcc
tcccgcggaggggtggccgccgacagtataggagaaaaagattttacagacattgaaagt
aaatttgctctaaggacccctgaagacacagctgaggacacttgccacatcattcctgga
gtggcagagtctgtggctaactgccacttcaaccacagcagcaaaaccttcgtggtgatc
catggctggacggtgacgggaatgtatgagagctgggtgcccaaactcgtggctgccctg
tacaagagggagccagactccaacgtcatcgtggtggactggctgtggcgggcccagcag
cactacccagtgtctgcgggctacaccaagctggtggggaaagatgtggccacatttatc
aactggatggcggaggaatttaactaccctctggataatgtccatctcttgggatacagc
ctgggggcccacgctgctggtgttgcaggaagtctgaccaataagaaggtcaacagaatt
acgggcctagatccagctggacctaactttgaatacgcagaagctccaagtcgcctttct
cctgatgatgcggattttgtagacgtcttacacacattcaccagagggtcaccgggccga
agtattggaatccagaaaccagtagggcatgttgacatttacccgaatggaggcacgttt
caaccaggctgtaacattggggaagctatccgtgtgattgcagagagaggccttggagat
gtggaccagctggtgaagtgttcccacgaacgctccattcatctcttcattgactctctg
ctgaatgaggaaaaccccagtaaggcctaccggtgcaattcaaaggaagcctttgagaaa
gggctctgcctgagctgcaggaagaaccgttgcaacaacgtgggctatgagatcaacaag
gtcagagccaagagaagcagcaaaatgtacctgaagactcgttctcagatgccttacaaa
gtcttccattaccaagtaaagatacatttttctggaactgagagtgacacacagaccaac
caggccttcgaaatctctctgtatggcactgtggccgagagtgagaacatccccttcacc
ctgcctgaaatttccacaaataagacgtactctttcctcatttacacggaggtggacatc
ggagaactgctgatgttgaagctcaaatggaatagcgactcctacttcagctggtccgac
tggtggagcagccctggctttgccattgagaagatcagagtgaaagcaggggagactcaa
aagaaggtgatcttctgttccagggagaaagtgtctcgtctgcagaaaggaaagtcacct
gtggtatttgtgaaatgccacgacaagtctctgaataaaaagtctaactga

DBGET integrated database retrieval system