KEGG   Myotis davidii: 102762887Help
Entry
102762887         CDS       T02992                                 

Gene name
GBA2
Definition
(RefSeq) glucosidase, beta (bile acid) 2
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
myd  Myotis davidii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102762887 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102762887 (GBA2)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102762887 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1021 aa AA seqDB search
MSAPEPDLGGNEAGQKSVPWQGGVSAWSLGAPERRQRGARGGFTAVASAAAAASAPGLHG
DTCSSQLPPAAGPPGRHLARVGTRLCTWLARYFVSEGAGPGAIEVVGTQDPGSMGTGVPA
SEQTSCAKGDPQVYCAKDTGDSEAVQVTDSESPEDSRSQDELGYSNPEDPGQLMASYEGR
AQGYQVPAFGWRICLAHEFAEKRKPFNANDISLSNLIKHLGMGLRYLQWWYQKTQVEKKK
PFIDLINSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHRTVIADQFTVCLR
REGQTVYQQVLSVERPSVLRSWNWGLCGFFAFYHALYPRAWTVYQLPGQNVTLTCRQITP
VLPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDDASGGLWNEPFCLERN
GETIQGLLLHHPTLPNXXXXXXXTCNPSSQPLLALXQADTTVTHITAFDPDGTGQQVWQD
LLQDGQLDSPAGRSTLSQKGVGIAGAVCVTSKLPPRGRCRMEFSLAWDMPRIMFGAQGQV
YYRRYTRFFGSDGDAAPALSHYALCRYADWEERISAWQSPVLDDRSLPAWYKSALFNELY
FLADGGTVWLEVPEDSLPEELGGNMCQLRPLLTEYGRFGYLEGQEYRMYNTYDVHFYASF
ALIMLWPKLELSLQYDMALATLGEDLTWRRYLMSGVMAPVKRRNVIPHDIGDPDDEPWLR
VNAYVIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLRDMWPVCLAVMESEMKFDKDQDGL
IENGGYADQTYDAWVTTGPSAYCGGLWLAAVAVMVQMAALCGTQDIQEKFSSILSRGQQA
YERLLWNGRYYNYDCSSRPQSCSIMSDQCAGQWFLRASGLGEGETEVFPTQHVVRALQTI
FEFNVQAFAGGTMGAVNGMQPQGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTA
EGCYRTVWERLGLGFQTPEAYCQKRVFRSLAYMRPLSIWAMQLALQQQHKKAELQTSRAQ
D
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctccggaaccggacctgggaggaaacgaagcgggtcagaagtcagtcccctgg
cagggaggggtgtctgcgtggagcttgggggccccggagagacgacaacggggagctcga
ggcggcttcactgctgtcgcctccgccgcagctgcagcctcagctcccgggttacacgga
gacacctgctcatcgcagcttcccccagcggccggcccgccaggacggcacctagcaagg
gtcggcacccgcctctgcacttggctggcgagatactttgtatccgaaggcgcgggacct
ggggccatcgaggtcgtggggacccaggatccagggagcatggggaccggagtccccgcc
tcggagcagaccagctgtgccaaaggggacccacaggtttactgcgctaaagacactgga
gactctgaggctgtgcaggtcactgactccgagagcccggaggacagtcgatcccaagat
gagctgggctacagcaatccggaggaccctgggcagctgatggcctcctacgagggcaga
gcccagggctaccaggtgcctgcctttggctggcgcatctgcttggctcatgagtttgcc
gagaagaggaaaccctttaatgccaatgacatctccctcagcaacctgataaagcacctg
ggcatgggcttgaggtacttgcagtggtggtaccagaagactcaggtggagaagaagaaa
cctttcatcgacctcatcaactctgtacccctgagacagatctatggttgtcccttgggt
ggtatcggaggaggcactataacccgaggctggagaggccagttctgtcgttggcagctt
aatcctggaatgtaccagcaccggacagtcattgctgaccaattcacagtgtgcttgcgt
cgggaagggcagactgtgtaccagcaagtcctgtccgtggagcgcccaagtgtcttgcgc
agctggaactggggcctgtgtgggttctttgcattctaccatgccctctatccccgagcc
tggactgtctatcagcttcctggccagaatgtcaccctcacctgccgccagatcacaccc
gtcttgccccatgactaccaggatagcagtctgcctgtaggagtctttgtgtgggatgtg
gaaaatgaaggtgatgaagccctggatgtgtccatcatgttctccatgcggaatggactg
ggaggtggggacgatgcttcagggggtttgtggaatgagcccttctgtctggagcgtaat
ggggagaccatacaggggctgctgctgcatcatccaacccttccaaatcnnnnnnnnnnn
nnnnnnntaacctgcaacccctcctcccaaccacttttggccctttaacaggcagacacg
acggtaacccacatcacagcttttgaccctgacggcactgggcagcaggtgtggcaggat
ctacttcaggatggacagctggactcccccgctggtcgaagcaccctctcgcagaaaggg
gtaggcatcgctggggctgtgtgtgttacgagtaagctgccacctcgaggccggtgccga
atggagttctcactggcctgggacatgcccagaatcatgtttggagctcagggccaggtc
tactacaggcgatacacaaggttctttggctcagatggtgatgcagcacccgcccttagt
cactatgcactgtgccgatacgcagactgggaagagaggatctcagcttggcagagccca
gtattggatgacaggtccctgcctgcctggtacaaatctgcactcttcaatgagctctac
ttcctggctgatggaggcacagtatggctggaagttcctgaggactccctaccagaggag
ctgggagggaacatgtgtcagctccgccccctcctcacggagtatggtcgatttggctac
cttgaaggccaggaatatcgcatgtacaacacatatgacgtccacttctacgcttccttc
gccctcatcatgctatggcccaaactcgagctcagcctgcagtatgacatggctctggcc
acacttggggaagacctgacatggcgacggtacctgatgagtggggtaatggcacctgtg
aaaaggaggaatgtcatcccccatgatattggggacccagatgacgagccatggctccgg
gtcaatgcgtatgtgatccatgatactgctgactggaaagacctgaatttgaagtttgtg
ctgcaggtttatcgggactattacctgacaggggaccagggcttcctgagggacatgtgg
ccggtgtgtctggccgtgatggagtctgaaatgaagtttgacaaggaccaagatggactc
attgaaaatggaggctatgcagaccagacctatgacgcttgggtcaccacaggccccagt
gcttattgtgggggactgtggctggcagctgtggctgtgatggtccagatggctgctctg
tgtgggacacaggacattcaagagaagttttcttccatcctcagccggggccagcaagcc
tatgagagactgctatggaatggccgctattacaactatgattgcagctctcggcctcag
tcctgtagcatcatgtctgaccagtgtgctggccagtggttcctgagggctagtggccta
ggagaaggagaaactgaggtatttcctacccaacacgtggttcgtgctctccaaactatc
tttgaattcaatgtccaggcctttgcaggagggaccatgggggctgtgaacgggatgcag
ccccagggtgtccctgatagatccagtgtccagtctgatgaagtctgggtgggcgtggtc
tatgggctggcagccaccatgatccaggagggcctgacttgggagggcttccagacagct
gaaggctgctaccgtactgtgtgggagcgcctgggcctgggcttccagaccccagaggca
tactgccaaaagcgagtgttccgctctctggcctacatgcggccactgagcatctgggcc
atgcagctggccctgcagcagcagcataaaaaggctgagctccaaacatccagggcacag
gactag

DBGET integrated database retrieval system