KEGG   Myotis davidii: 102762892Help
Entry
102762892         CDS       T02992                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
myd  Myotis davidii
Brite
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102762892 (TGM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MGLRRLIVRRGQPFTLQLHFNRPFHCGTDHITFVAETGPAPTKLSGTRATFGLTQARQGN
AWSASDFTIDSNSLFVSLFTPASAVIGPYTLKIAISQGQGYSMTHPVGTFILLFNPWSAE
DDVYLPSEILLREYIMMDYGFVHKGHEQFITSWPWNYGQFEEDIIDICFEILNKSLYFLE
NPSKDYSQRNDVVYICRVVSAMINSNDDNGVLQGNWGEDYSQGISPLEWNGSVAILRQWS
ARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVVSNFRSAHNVDGNLTIDTYYDRNAEMLS
TQKRDKVWNFHVWNECWMIRKDLPPGFNGWQVLDPTPQQTSSGLFCCGPASVKAIREGEI
HLPYDTPFVYAEVNADEVIWLFGDGQAQEVLAHNTSSIGKKISTKLVGSDQRQDITSSYK
YPEGSPEERSVFMKASRKMLGHRRASSPFLDLLGSEGLRDQPALLRLHLTRTPEWGQDLL
LTLHARRVPHRAHPRGPLRLEVRFCAQALMHKGGTRQPLWRQIVHLNLDFGEEIQWPLLL
PYNNYRNKLTDEKLIRVSGIAEVEGTGRSILVLKDISLEPPHLSIEVSERAEVGKPLKVH
ITLTNTQTVALSHCTMVLEGSGLIHGQVSNDLGTLVAGHTIQIQLDLYPFKAGPRQLQVL
ISSNEVKEIKGYKDVFVAAARPS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgaggcggctcatcgtgcgccggggccagcccttcacgctccagctgcatttc
aaccgacctttccactgcgggaccgaccacatcaccttcgtggctgagaccggaccagca
cccacgaagctgtcaggaacccgagccacctttggactcacccaggctcgacaagggaat
gcctggagtgcttctgacttcaccatcgactccaactcactctttgtctcccttttcaca
ccagccagtgcagtcattggtccctacactctgaagatagccatctctcaaggccagggt
tacagcatgactcacccagtggggactttcatcctgctttttaacccttggagtgcagag
gatgacgtctacctgcccagtgaaatactgctgcgagagtatatcatgatggactatggc
tttgtgcacaagggtcatgaacaattcatcacctcctggccctggaactacgggcagttt
gaagaggacatcatagacatctgctttgagatcctgaacaagagcctgtacttcttagag
aacccatccaaagactactcgcagcggaacgacgtggtgtacatctgcagggtggtgagc
gccatgatcaacagcaacgatgacaacggcgtgttgcaggggaactggggcgaggactac
tcccagggcatcagcccactggagtggaatggcagcgtggccatcctgcggcagtggtca
gccaggggcgggcagcctgtgaagtatggacagtgctgggtctttgcagctgtcatgtgc
accgtaatgagatgcttaggtgttccaacccgtgttgtttccaatttccgttctgcacac
aacgtggatgggaacttgaccatagatacctactatgaccgaaatgcagaaatgctgtca
actcagaaacgggacaaagtatggaatttccacgtctggaacgagtgctggatgatccgg
aaagacctcccccctggattcaatgggtggcaggttctggaccccacaccccagcaaacc
agcagcgggctgttctgctgtggccctgcctccgtgaaggccatcagggaaggggagatc
cacctgccctacgacaccccatttgtgtacgcggaggtaaatgccgatgaggtcatttgg
ctctttggggatggccaggcccaggaagtcctggcccataacaccagttccatcgggaag
aaaatcagcaccaagttggtaggatcagaccagcgccaggacatcaccagctcctacaag
tacccagaaggatctcccgaggagcgctctgtgttcatgaaggcatcccggaaaatgctg
ggccacagaagggcctcgtcccccttcctggatctgctggggtccgagggcctccgggat
cagccagcgctgctgcggcttcacctgaccaggacccccgagtggggccaggacctgctg
ctgacgctgcatgccaggagggtgccacacagagcccacccccgggggcccctcagactg
gaggtgcgcttctgcgcccaggccctgatgcacaagggtgggacccggcagcccctctgg
aggcaaatagtgcacttgaacctggactttggggaggagatacagtggccgctcttgcta
ccctacaacaactacagaaacaagctgaccgatgaaaagctgattcgcgtgtctggcatc
gcggaggtggaggggaccgggaggtccatactggtcctgaaagatatctctctggagcct
ccccacttatctattgaggtgtctgagagggctgaggtgggcaagccactgaaagtccac
atcaccctcaccaacacccagacggtggctctgagtcactgcacgatggtgctggaggga
agtggcctcatccacgggcaggtgtcaaatgaccttgggactctggtggcaggacacacc
atccaaatccaactggacctctaccccttcaaagctggaccccgccagctacaagtcctc
atcagcagcaacgaagtcaaggagatcaagggctacaaggacgtcttcgtagcagcggcc
aggccttcctga

DBGET integrated database retrieval system