KEGG   Myotis davidii: 102763458Help
Entry
102763458         CDS       T02992                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
myd  Myotis davidii
Brite
Enzymes [BR:myd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102763458 (PCSK1)
Peptidases [BR:myd01002]
 Serine Peptidases
  Family S8: subtilisin family
   102763458 (PCSK1)
Chaperones and folding catalysts [BR:myd03110]
 Intramolecular chaperones
  Subtilisin family
   102763458 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 718 aa AA seqDB search
MQRGAWTLQCTAFALFCAWCALNSVKAKRQFVNEWAAEIPGGPAAASAIAEELGYDLLGQ
IGSLENHYLFRHKNHPRRSRRSALHITKRLSDDDRVIWAEQQYGKERSKRSVLRDSAVNL
FNDPMWKQQWYLQDTRMTASLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENNCSGIRMLDGIVTDAIEASSIGFNPGHVDIYSAS
WGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIY
TISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQRITSADLHNDCTGTHTGTSASAPL
AAGIFALALEANPNLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAK
ALVDLADPRTWCVIKDNDFEPRALKANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEY
SRRGDLHVTLTSALGTNTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLRITDMS
GRMQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTEEN
LNEKPPTAKSLSSSSGRNREEEQAEGAASEAMLRLLQSAFRRNSPPKQSPKKSPSAKPNI
PYENFYEALEKLNKPSHLRDTEDSLYNDYADVFYSTKPYKHRDDRLLQALVDLLREEN
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaggagcctggactctgcagtgcactgctttcgctctcttttgcgcttggtgt
gcattgaacagtgtaaaagcgaagaggcagtttgtgaacgaatgggcagcggagatcccc
gggggaccagcggcagcctcggccatagccgaagagctgggctacgaccttttgggtcag
attggatcactcgaaaatcattacttattcagacataaaaaccacccccggaggtctcga
aggagtgcccttcatatcactaagagattatctgatgatgatcgtgttatatgggctgaa
caacagtatggaaaggagagaagtaaacgttcagttctgagagactccgcagtaaatctc
ttcaatgatccgatgtggaagcagcagtggtacttgcaagatactaggatgaccgcatcc
ctgcccaagctggacctccatgtgatacctgtttggcaaaaaggcatcactggcaaagga
gttgttatcactgtactggatgatggcttggagtggaatcacacagacatctatgccaat
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaactgttcaggcataagaatgttggatggcattgtgaccgat
gctattgaagccagttcaattggattcaatcctgggcatgtggacatttacagtgcgagc
tggggcccgaacgacgatgggaaaactgtggaggggcctggtcgactcgcccagaaggca
tttgaatatggtgttaaacaggggagacaaggaaagggctccatctttgtctgggcatct
ggaaacggggggcgtcagggagataactgtgactgcgacgggtacacagacagcatctac
accatctccatcagcagtgcctcgcagcagggcctgtccccctggtacgcggagaagtgc
tcctccacgctggccacctcgtacagcagcggggattacactgaccagcgaatcacgagt
gctgacctgcacaatgactgcacagggacccacacgggcacctcggcctctgcacccctg
gctgctggcatcttcgctctggccctggaagcaaatccaaatctaacctggcgagacatg
cagcacttggttgtctggacctctgagtatgacccactggccaataaccctggatggaaa
aagaatggcgcaggcttgatggtgaacagtcggtttggattcgggctgctaaatgccaaa
gctctggtggacttagctgatcctagaacctggtgtgtgataaaggacaatgactttgag
cccagagccctgaaagctaatggagaagttatcattgaaattccaacaagagcttgtgag
ggacaggaaaatgctatcaagtccctggaacatgtacaatttgaagcaacaattgaatat
tcccgaagaggagaccttcatgtcacactcacttctgctcttggaaccaacactgttcta
ttggctgaaagagagcgggatacatctcctaatggctttaaaaattgggacttcatgtct
gttcacacatggggagagaacccagtaggcacctggactttgcgaattacagacatgtct
ggaagaatgcaaaatgaagggagaattgtgaactggaagctgattttgcacgggacctct
tctcagccagaacacatgaaacagccccgcgtgtacacgtcctacaacaccgtgcagaat
gacagaagaggggtggagaaggtggtggactcaggggaggagcagcccacagaagagaac
ctgaatgagaagcctccgactgcaaaaagcctcagcagcagcagtgggagaaacagagag
gaggagcaggcggagggagctgcgtccgaggccatgctgcgactcctacaaagcgccttc
agaagaaactcgccaccaaagcaatcaccaaagaagtctccgagtgcaaagcccaacatc
ccttacgaaaatttctacgaagccctggaaaagctgaacaaaccttcccaccttagagac
accgaggacagcctgtataacgactatgccgatgttttctatagcaccaagccttacaag
cacagagatgaccggctgctgcaagctctggtggaccttctgagggaggaaaactaa

DBGET integrated database retrieval system