KEGG   Myotis davidii: 102763656Help
Entry
102763656         CDS       T02992                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
myd  Myotis davidii
Pathway
myd00350  Tyrosine metabolism
myd01100  Metabolic pathways
Module
myd_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102763656 (DBH)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102763656 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 102763656
NCBI-ProteinID: XP_015427857
Position
Un
AA seq 594 aa AA seqDB search
MENFLEVAAHASMYGTAVAVFLVILVAALQGSTPPESPFPYRIPLDPEGTLELSWNVSYA
QETIHFQLLVRGLQAGVLFGMSDRGELENADLAVLWTDGDSAYFGDAWSDQKGQIHLDAQ
QDYQLLQAQRTPQGLTLLFRRPFSTCDPRDYLIEDGTVHLVYGILEQPFSSLEAINTSGL
RTGLQRVQYEPIVTKGNEALVHHMEVFQCAAGFESFPHFSGPCDSKMKPERLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIQGRRDSSGIRLYYTATLRRF
DAGIMELGLVYTPVMAIPPGEAAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLARDGRERAIVNRDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRTLATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDPGFLQKYFHLVNRFNSEEVCTCPQTSVPEQFA
SVPWNSFSRDVLQALYGFAPLAMHCNKSSAVRFQGEWDLQPLPEIVSQLEVPAPTLLPKG
LPPGRRDSSGIRLYYTATLRRFDAGIMELGLVYTPVMAIPPGEAAFVLQGPPSL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttcctggaagtggcagcacacgcctccatgtacggcacagccgtggccgtg
ttcctggtcatcctggtggccgcgctgcagggctcgacgccccccgagagccccttcccc
taccgcatccccctggaccccgaggggaccctggagctctcctggaacgtcagctacgcg
caggagaccatccacttccagctgctggtgcgcgggctccaggccggggtgctgttcggg
atgtcggaccgcggggagctggagaacgctgacctggccgtgctctggacagacggggac
agcgcctactttggggacgcctggagtgaccagaagggacagatccacctggacgcccag
caggactaccagctgctgcaggcccagaggaccccgcagggcctgaccctgctcttccgg
cggcccttcagcacctgcgacccccgggactacctcatcgaggacggcaccgtccacctg
gtgtacgggatcctggagcagcccttctcgtcgctggaggccatcaacacctcgggcctg
cgcacggggctgcagagggtgcagtacgagcccattgtcaccaagggcaacgaggcgctg
gtgcaccacatggaggtgttccagtgcgcggccgggttcgagagcttcccccacttcagc
gggccctgcgactccaagatgaagccggagcgcctcaactactgccgccacgtgctggcc
gcctgggccctgggcgccaaggccttttactacccggaggaagcgggccttgctttcggg
ggtgccgggtcctccaggtttctccgcctggaagttcactaccacaacccactcaagata
caaggccggcgggactcctcgggcatccgcctgtactacacggccacgctgcggcgcttc
gacgcgggcatcatggagctgggcctggtgtacacgcccgtgatggccatcccccccggg
gaggcggccttcgtgctcacgggctactgcacggacaagtgcacgcagctggccctgcct
ccctcggggatacacatctttgcctcccagctgcacacgcacctgaccgggcggaaggtg
gtcaccgtgctggcccgggacggccgggagagggccattgtgaacagggacaaccactac
agcccccacttccaggagatccgcatgctgaagaaggtcgtgtccgtccacccaggcgac
gtgctcatcacttcctgtacatacaatacggaagacaggacgctggccaccgtgggcggc
ttcggcatcctggaggagatgtgtgtcaactacgtgcactactacccgcagacgcagctg
gagctgtgcaagagcgccgtggaccccggcttcctgcagaagtacttccacctcgtcaac
aggttcaacagcgaggaggtgtgcacctgcccccagacctccgtccccgagcagtttgcc
tccgtcccctggaactccttcagccgcgacgtgctccaggccctgtacggcttcgccccc
cttgccatgcactgcaacaagtcctcggccgtgcgcttccagggggagtgggatctgcag
ccgctgcccgagatcgtctcgcagctggaagtgcccgcccccacactgctgcccaagggt
ctgcctcctggccggcgggactcctcgggcatccgcctgtactacacggccacgctgcgg
cgcttcgacgcgggcatcatggagctgggcctggtgtacacgcccgtgatggccatcccc
cccggggaggcggccttcgtgctccaaggccctcccagcctgtaa

DBGET integrated database retrieval system