KEGG   Myotis davidii: 102763967Help
Entry
102763967         CDS       T02992                                 

Gene name
NEU4
Definition
sialidase 4
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
myd  Myotis davidii
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102763967 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102763967 (NEU4)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102763967 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
MGAPRVPTRTVLFQSERSGLTYRVPALLPVAPGPTLLAFAEQRLSPTHQPLPSADWATFA
VGPGHGIQLRSGRLLVPAYTYHVDRRECFGKICRTSPHAFTFYSDDHGQTWRHGGLLSNL
RSGECQLAVVDGGRAGSVLYCNARSPLGSRVQALSTDEGTSFLPGELVPTLAETARGCQG
SILGFPAPHSNRPGDEGWSVGSRKTPFSPNLCPGAHKSPKEWAGDTQRGGGVDGTKGCGG
GTELSGDPSPGPELSGDGRAWSLQLPRLPAALPQSPTWLLYSHPAGRRARLHMGVHLNRS
PLDPHSWTEPWVIYQGPSGYSDLASIGPTPEGSLTFACLYESGTRVSYEEISFCVFSLRE
VLENVLPGPEPTGLGNKPWEQCWPS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggggccccccgagtccccacgcggaccgtgctcttccagagcgagaggagcggcctg
acctaccgcgtgcccgcgctgctgcccgtggccccggggcccaccctgctggccttcgca
gagcagcggctcagccccacccaccagcccctcccgtctgcagactgggccacatttgcc
gtgggcccaggccacggcatccagctgcgctcgggccgcctgctggtgccggcctacacc
taccacgtggaccggcgggagtgcttcggcaagatctgcaggaccagcccccacgccttc
accttctacagcgatgaccatggccagacctggcgccatggcggcctcctgtccaacctg
cgctcgggcgagtgtcagctggctgtggtggacggagggcgggcgggcagtgtcctctac
tgcaatgcccggagccccctgggcagccgtgtgcaggccctcagcacagatgagggcacc
tccttcctaccgggagagctggtgcccactctggccgagacggcccggggttgccagggc
agcatcctgggcttcccagccccacactctaataggcctggcgatgagggatggtcagtg
ggctccaggaagactcccttttctccaaatctctgtcctggagcccacaaatccccgaag
gagtgggctggagacacccaaaggggtgggggtgttgatgggacaaagggatgtgggggc
gggacagagctatcaggggatcctagcccagggcctgagctcagtggggacgggagggcc
tggtccctgcagctccctaggctccctgctgccctgcctcagagccccacgtggctgctg
tattcccacccagcggggcgcagggctcggctccatatgggtgtccacctgaacaggtcc
cccctggatccacacagctggacggagccttgggtgatctaccagggccccagcggctac
tctgacctggcatccatcgggcccacccctgagggctccctgaccttcgcgtgtctatat
gagagtggaaccagggtgtcctacgaggagatctctttctgcgtgttctccctgcgtgag
gtcctagagaatgtgcttccgggccccgagccaacaggcctggggaacaagccttgggag
cagtgctggccctcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system