KEGG   Myotis davidii: 102763968Help
Entry
102763968         CDS       T02992                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
myd  Myotis davidii
Brite
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102763968 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 820 aa AA seqDB search
MMDGPRSDVGRWGVSPWQPPTTPSPEPEPEPDRRSRRGSRSFWARCCSCCSCRSGADDDW
GTGPHRDSGSRGGGSSSGGRRPGSRGSDSRRPISRGSGVNAAGDGVIREGMLVVTGVDLM
CSRSDQNRQEHHTDEFEYDELILRRGQPFHMVLFLSRPYESSDRVILELHIGNNPEVGKG
THVIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTVRTHSEAGEFLLPFD
PHNEIYILFNPWCPEDIVYVDREDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVL
DACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGS
VEILLSYLRTGSSVPYGQCWVFAGVTTSVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFD
ENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSLQ
SIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMQE
DVTHLYKHPEGSEAERKAVETATAHGSKPNVYATRDSAEDVAIQVEAQDAVMGQDLAVSV
LLTNRSSSSRRTVKLHLYLSVTFYTGVTGSVFKENKKEVVLAPGASDRVTMPVAYQEYKP
HLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAMVGQECEVQIVFKNPL
PITLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQ
VHGVIQVDVAPASGSRGVFSDAGGSSRSGETIPMASRGGA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgttccgatgtgggccgctggggcgtgagcccctggcagcccccc
acaacaccctccccggagccggagccggagccggacagacggtcccgcagaggaagccgt
tccttctgggctcgatgctgcagctgctgctcctgccggagtggggcggacgatgactgg
gggactgggccccacagagactctggctccaggggtggagggtccagctctgggggacga
aggcctggctcccggggctcagactcccgccggcctatctcgcggggcagcggtgtgaac
gcggccggagatggtgtcatccgagagggcatgttggtggtgacgggtgtggatctcatg
tgttcacgctcggaccagaaccgccaagagcaccacacagacgagttcgagtacgatgag
ctgatcctgcgccgtgggcagcctttccacatggtgctcttcctgtcgcggccctacgag
tcctccgaccgcgtcatcctggagctgcacatcggaaacaaccccgaggtgggcaagggc
acccatgtgatcatcccggtgggcaaggggggcagtggaggctggaaggcccaggtgacc
aagtccagtgggcagaatctgaacctgcgggtccacacctcccccaacgccatcatcggc
aagtttcagttcacagtccgcacacattcagaggctggcgagttcctgttgcccttcgac
ccccacaatgagatctacatcctcttcaatccctggtgcccagaggacatcgtgtatgtg
gaccgtgaggactggcggcaggagtacgtgctcaatgagtctgggaggatttactatggg
actgaagcacagattggggagcggacgtggaactacggccagtttgaccatggggtgctg
gatgcctgcctgtacatcctggaccggcggggcatgccatatggaggccgtggggaccca
gtcagtgtctcccgagtcatctctgccatggtgaactccttagatgacaatggggtcctg
attgggaactggtctggcgattactcccgaggcaccaacccgtcagcgtgggtgggcagc
gtggagatcctcctcagctacctgcgcaccggctcctctgtcccctacggccagtgctgg
gtcttcgccggtgtgaccacctcagttttgcgctgcttgggcctggccactcgtaccgtc
accaacttcaactcagcgcatgacacagacacgtccctcaccatggacatctacttcgat
gagaacatgaagccgctcgagcatctgaaccatgattctgtctggaacttccacgtgtgg
aatgactgctggatgaagaggccggatctgccctcgggctttgatggttggcaggttgtg
gatgccacaccccaggagaccagcagtggcatcttctgctgtggcccttgctccctgcag
tccatcaagaatggcctggtctacatgaagtacgacacacccttcattttcgccgaggtg
aacagtgacaaggtttactggcagcgacaggacgatggcagcttcaagattgtgtacgtg
gaggagaaggccattggcacactcatcgtcacaaaggccattggctccaacatgcaggag
gatgtcacccacctttataagcacccagaaggctcagaagcagagcggaaggcagtggag
acagcaaccgcccatggcagcaaacccaatgtgtacgccacccgggactcagctgaggac
gtggcgatacaggtggaggcccaggacgcagtgatggggcaggatctggcggtcagcgtg
ttgctgaccaatcgcagcagcagcagccgccgcaccgtgaagctgcacctctacctctcg
gtcaccttctacaccggtgtcaccgggtccgtcttcaaggagaacaagaaggaagtggtg
ctggctccaggggcctcggaccgtgtgaccatgccggtggcctaccaggaatacaagccc
caccttgtggaccagggggccatgctgctcaatgtctccggccacgtcaaggagagcggg
caggtgctggccaagcagcacacgttccgcctgcgcaccccggacctctccctcacgttg
ttgggagcagctatggttggccaggagtgcgaagtacagattgttttcaagaaccccctg
cctatcaccctcaccaacgtagtcttccggctcgagggctccgggttacagagacccaag
atcctcaacgtgggggacattgggggcaacgagacagtgacgctgcgccagacgttcgtg
cctgtgcgaccagggccccgccagctcatcgccagcttggacagcccacagctctcgcag
gtgcacggtgtcatccaggtggacgtggccccagcctccggcagccggggtgtcttctca
gatgccggaggcagcagtcgctcaggagaaactattcctatggcttctcgaggtggggct
tag

DBGET integrated database retrieval system