KEGG   Myotis davidii: 102766021Help
Entry
102766021         CDS       T02992                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
myd  Myotis davidii
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:myd00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102766021
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102766021
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102766021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MRTILIISLLSCFFAAYNAKVFSKCELARQLKAHGMDGFHGYSLANWVCMAEHESSFNTR
AFNGRNSNGSSDYGIFQLNNQWWCKDNKYPSENACNIMCSKFLDDNISDDINCIKRVVRD
PNGMSAWVAWVNHCRNKNLSQYLAGCQL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggacaatcctgattatctccctcctcagctgcttctttgcagcttacaatgccaag
gtcttctccaaatgtgagctggcccgccagctgaaggctcatggaatggatggcttccat
ggctacagcttggcaaactgggtctgcatggctgagcatgagagtagcttcaacacccgg
gcttttaatggaagaaactccaatggcagcagtgactatgggatcttccagctgaacaac
cagtggtggtgcaaggacaacaagtatccctcagaaaatgcctgcaacataatgtgcagc
aaatttctggatgataacatcagtgacgacatcaactgtatcaagagggttgtgagagat
cctaacgggatgtctgcttgggtggcctgggtaaatcactgcagaaataagaatttgtcc
caatacctggccggctgtcaactgtga

DBGET integrated database retrieval system