KEGG   Myotis davidii: 102767031Help
Entry
102767031         CDS       T02992                                 

Gene name
TGM2
Definition
transglutaminase 2
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
myd  Myotis davidii
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:myd00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    102767031 (TGM2)
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102767031 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
MAEDLNVEKWDLELEANGRDHHTADLCRERLVVRRGQYFRLTLHFQGRSYEASVDRLTFS
VSTGPAPSQEAGTKARFPLSDAVEEGAWTASVLDQQDSELSLQLIAPAHAPIGLYRLSME
ASTGYQGSSFMLGNFTLLFNPWCPADAVYLDXXXXXXERQEYVLAQQGFVYQGSAKYIHS
VPWNFGQFEDEILDTCLKLLDINPKYLKNSGRDCSRRSSPVYVGRVVSAMVNCNDDQGVL
LGRWDNNYADGVSPMFWIGSVDILRRWKNYGFQKVKYGQCWVFAAVACTVLRCLGIPTRV
VTNYNSAHDSNSNLLIEYFRNEFGEFEGNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAL
DPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVEWIRQADGSMHKSIN
NSMMVGQKISTKSVGRDQREDITHNYKYPEGSPEEREAFRKANNLNKLAAKEETGVAMRI
RVARSMKMGSDFDVFAHITNDTEENHACRLLLCARTVSSNGTLGPVCSSKNLLDLSLEPH
SENSISLPILYENYCDYLTESNLIKVRGLLIEPAADTYLLAERDIYLENPEIKIRILGEP
KKNRKLVAEVSLQNPLTEPLEGCTVTVEGAGLTETQKTVDIPDPVEAGQEVKVRVDLLPV
QVGLHKLVVNFDSNKLKAVKGYRNVIIGPP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctgaatgtggagaaatgggacctggagctggaggccaatggccgtgac
caccacacggcagacctgtgccgagagaggctggtggtacggcggggccagtacttccgg
ctaacgctgcatttccagggcagaagctatgaggccagtgtggaccgcctcaccttcagt
gtctcaactggcccagcccccagccaggaggcagggaccaaggcccgcttcccgctgtcc
gatgctgtggaggagggtgcctggacggcctcggtgttagaccagcaggacagtgaactc
tcgctgcagctcattgccccagctcacgcccccatcggcctataccgcctcagcatggag
gcctccaccggctaccagggctccagcttcatgctgggcaacttcaccctgctcttcaac
ccctggtgcccagcggacgctgtgtacctggacnnnnnnnnnnnnnnnnnngagcggcag
gagtatgtcctcgcccagcagggcttcgtctaccagggctcggccaagtacatccacagt
gtcccttggaactttgggcagtttgaagacgagatcctggacacctgcctgaagctcctg
gacatcaaccccaagtacctgaagaacagtggccgtgactgctcccgccgcagcagcccg
gtctatgtgggccgggtggtgagcgccatggtcaactgcaatgacgaccagggtgtgttg
ctgggacgctgggacaacaactacgcggacggcgtcagccccatgttctggatcggtagc
gtggacatcctgcggcgctggaagaactacggcttccagaaggtcaagtacggccagtgc
tgggtcttcgctgctgtggcctgcacagtgctgcggtgcctggggatccccacccgagtc
gtgaccaactacaactcggcccatgactcgaacagcaatctgctcatcgagtacttccgc
aacgagttcggggagttcgagggtaacaagagcgagatgatctggaacttccactgctgg
gtggagtcctggatgaccaggcctgacctgcagccgggctatgaggggtggcaggccctc
gaccccacgccccaggagaagagtgaagggacatactgctgtggcccggttccagttcgt
gccatcaaggaaggtgacctgagcaccaagtacgacgccccttttgtctttgccgaggtc
aatgccgatgtggtggaatggatccggcaggcggatgggtccatgcacaagtccatcaac
aactccatgatggtggggcagaagatcagcactaagagtgtgggccgtgaccagcgggag
gacatcacccacaactataagtaccccgaggggtccccagaggagagggaggccttcagg
aaggccaacaacctgaacaagctggcagctaaagaggagacgggggtggccatgcggatc
cgagtggcccgaagcatgaaaatgggcagcgacttcgacgtctttgcccacatcaccaac
gacactgaggagaaccacgcctgccgcctcctgctctgtgctcgcactgtcagctccaat
gggacgctggggccagtgtgcagctccaagaacctgctcgatctttccctggagccccat
tccgagaacagcatctcccttccaatcctctatgagaattactgtgactacctgacggag
tcgaacctcatcaaggtgcggggcctcctcatcgagccagctgccgacacctacctgctg
gccgagagggacatctatctggagaatccagaaatcaagatccggatcctgggggagccc
aagaagaaccgcaagctggtggccgaggtgtctctgcagaacccgctcaccgagcccctg
gagggctgcaccgtcactgtggagggggctggcctgaccgagacacagaagaccgtggac
atcccagaccccgtggaggcggggcaggaagtcaaggtcagagtggacctgctgcctgtc
caagtgggcctccacaagctggtggtcaacttcgacagcaacaagctgaaggccgtgaag
ggctaccggaatgtcatcattggccccccctaa

DBGET integrated database retrieval system