KEGG   Myotis davidii: 102767238Help
Entry
102767238         CDS       T02992                                 

Gene name
JOSD1, Josephin-1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
myd  Myotis davidii
Brite
Enzymes [BR:myd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102767238 (JOSD1)
Peptidases [BR:myd01002]
 Cysteine Peptidases
  Family C86
   102767238 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWRGDKAKSESPEPPQAAPPRIYHEKQRRELCALHALNNVFQDGGAFNRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSAIALTNVMGFIM
NLPSSLSWGPLKLPLKRQHWICVREVGGAYYNLDSKLKTPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRADM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgtgccatggcggggagacaaggccaagtccgagtccccggagccgccccag
gccgcgcccccccggatctaccacgagaagcagcgccgcgagctctgcgccctgcacgcc
ctcaacaacgtcttccaggacggcggcgccttcaaccgggagacgctgcaggagattttc
cagaggttgtctccaaacaccatggtgaccccccacaagaagagcatgctgggaaatggg
aactacgatgtgaacgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggacgtcagtgccattgctctcactaacgtcatgggcttcatcatg
aatctgccctccagcctgagctggggtccactgaagttgcctctcaaaaggcagcactgg
atctgtgttcgggaggtgggcggtgcctactacaacctggactccaagctgaagacgccc
gagtggattggaggcgagagcgagctcaggaaatttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtggaggcccatcagagctggagggct
gatatgtaa

DBGET integrated database retrieval system