KEGG   Myotis davidii: 102769198Help
Entry
102769198         CDS       T02992                                 

Gene name
NEU2
Definition
sialidase 2 (cytosolic sialidase)
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
myd  Myotis davidii
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102769198 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102769198 (NEU2)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102769198 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 379 aa AA seqDB search
MASFPVLQKERVFKSGAQAYRIPALLYLPQQKTLLAFAERRKSKKDEDAELIVLRRGSYD
ESTHQVQWHAQEEVAQAQLEGHRSMNPSPLYDKKTRTLFLFFIAIPRQVSEHHQLHTKVN
VTRLCQVTSTDHGRSWSPTRDLTDSAIGSAHGEWATFAVGPGHCLQLHNEAQSLVVPAYA
YRKLRAHGWPSPSAFCFISHNHGLTWERGNFVAPETVECQVAEVGGAKQRMIYLNARSPR
GVRIQAESVNDGLDFRGAQLVQKLVEPPHGCHGSVIAFPSPRAGSGSSDKWLLYTHPTDP
RQRTNLGAYLNTRPPASNAWSHPTLLAEGSCAYSDLQSLGVGPDGSPQFGCLYEHDNYEE
IIFLMFTLKQVFPTEFSAQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcatccttccccgtcctgcagaaggagagagtgttcaagtcgggagcacaggcctac
agaatccctgctctactctacctgccgcagcagaagactctgctggccttcgcagaaagg
cgcaagagcaagaaggatgaggatgcagagctgattgtcctgcgcaggggaagctatgat
gagtcaacccaccaggtccagtggcacgctcaggaagaggtggcccaagcccagctggag
ggccaccggtccatgaatccaagtcccttgtatgacaagaaaacgaggaccctcttcctc
ttcttcattgccatccccaggcaggtctctgagcatcaccaactccacaccaaggtcaat
gtgacacggctgtgccaagtcaccagcaccgaccacggcaggtcctggagccccaccaga
gacctcaccgactctgccattggctcggcccatggggaatgggccacctttgcggtgggc
ccggggcactgtctgcagctacacaatgaggcgcagagcctggtggtgccagcctacgcc
taccggaaactccgtgcccacgggtggcccagcccctccgctttctgcttcatcagccac
aaccacgggctcacgtgggaaagaggcaactttgtggccccggaaactgtggagtgccaa
gtggctgaggtcgggggtgcaaaacagaggatgatatatctcaatgctagaagcccccgt
ggggtcaggattcaggccgagagtgtcaacgacgggcttgatttcaggggggcccaactg
gtccagaagcttgtggagcctcctcatggctgccatgggagtgtgatcgccttccccagc
cccagagcggggtcaggctcctcagacaagtggctgctctacactcaccctactgacccc
cggcagagaaccaacctaggtgcctacctcaatacacggcccccagcctctaacgcctgg
tcccacccgaccctgctggctgagggcagctgcgcctactcagaccttcagagcctgggt
gtcggccccgatggctcaccccagtttgggtgtctgtacgaacatgataactacgaggaa
atcatcttcctcatgttcaccctgaaacaagtcttcccaactgaattttcggctcagtga

DBGET integrated database retrieval system