KEGG   Myotis davidii: 102771724Help
Entry
102771724         CDS       T02992                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
myd  Myotis davidii
Pathway
myd00561  Glycerolipid metabolism
myd01100  Metabolic pathways
myd04714  Thermogenesis
myd04723  Retrograde endocannabinoid signaling
myd04923  Regulation of lipolysis in adipocytes
Module
myd_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102771724 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102771724 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102771724 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102771724 (MGLL)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102771724 (MGLL)
Peptidases [BR:myd01002]
 Serine Peptidases
  Family S33
   102771724 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 PGAP1 Abhydrolase_3 DLH Abhydrolase_5 Thioesterase Peptidase_S9 DUF1057 LIDHydrolase BAAT_C DUF2974 Abhydrolase_2 FSH1
Motif
Other DBs
NCBI-GeneID: 102771724
NCBI-ProteinID: XP_006763284
Position
Un
AA seq 351 aa AA seqDB search
MPRSDLGDEGTALICPALLCPALILQAVVAVECPNQDMMETGLGDPFRMPEESSPRRTPQ
NVPYQDLPHLVNADGQYLFCRYWKPAGPPKGLVFVSHGAGEHCGRYDELAQMLVGLQLLV
FAHDHVGHGQSEGERMVVSDFHVFVRDALQHVDVVQKDHPGLPVFLLGHSMGGAIAILTA
AERPSHFSGMVLISPLVLASPESATTFKVLAAKVLNFVLPNMSLGPIDSSVLSRNKTEVD
VYNTDPLICRAGMKVCFGMQLLNAVSRVERALPKLTLPFLLLQGSADRLCDSKGAYLLME
SAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEIKMWVSQRTAAARTGSPP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctctgacctcggcgatgagggaactgcccttatctgcccggccctcctctgc
ccggctctaattctccaggctgtcgtggcggtggaatgcccaaaccaggacatgatggaa
acaggacttggagatcctttcagaatgccggaggaaagttctcccaggcggaccccgcaa
aacgttccgtaccaggacctccctcatttggtcaacgctgatggacagtacctcttctgc
aggtactggaaacccgccgggcctcccaagggcctcgtctttgtgtcccatggagccggg
gagcactgtggccgctatgatgaactcgctcagatgctggtggggctgcaactgctggtg
ttcgcccatgaccatgtgggccacggacagagcgaaggggagaggatggtagtgtccgac
ttccacgttttcgtcagggatgcgttacagcacgtggatgtcgtgcagaaagaccacccg
gggctgcccgtcttccttctgggccactccatggggggcgccatcgccatcctcacggcc
gcggagaggccaagccacttctctggcatggttctcatttcacctttggttctggccagt
cctgagtccgcaacaactttcaaggtccttgctgcgaaggttctcaactttgtcctacca
aacatgtccctgggcccgatcgactccagcgtgctctctcggaataagacggaggtcgac
gtttataacacggaccccctcatctgccgggcagggatgaaagtgtgcttcggcatgcag
ctgctcaatgctgtctccagggtggagcgggccctccccaagctgaccttgcccttcctg
ctgctccagggctctgctgaccgcctgtgcgacagcaaaggggcctacttgctcatggag
tccgccaagagccaggacaagacactcaagatttacgaaggtgcctaccacgttctccac
aaagagcttcctgaagtaaccaactctgtcttccatgaaataaagatgtgggtctctcaa
aggacagcggcggcgagaacagggtccccaccctga

DBGET integrated database retrieval system