KEGG   Myotis davidii: 102775283Help
Entry
102775283         CDS       T02992                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
myd  Myotis davidii
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102775283
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     102775283
Cytochrome P450 [BR:myd00199]
 Cytochrome P450, animal type
  CYP21 family
   102775283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 216 aa AA seqDB search
MMTVTRGYRCNAGNRHTGRGLPPVQRENTQTAQLIVFSEGPGAPLLTCSIICHLTFGDQV
KEEAVVHAFHDCVQDLMRTWDHWSIHILDIVPFLRFFPSPGLRRLKQAVESRDHMVEGQL
RRQEESMVTGRWRDAMDYMLQGVGKPPAQQGSGQLLEGHVHMSVVDLFIGGTSTTSTTLS
WAVAFLLHHPEVLRRLQEELDRELGPGAWCSPVPYK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtcacacggggctacaggtgtaacgcaggaaaccggcacaccggccgcggg
ctcccgcctgtgcagcgggagaacacacagaccgcgcagctcatcgtgttttcggagggt
cctggggcccctctcctcacctgcagcatcatctgtcacctcacctttggagaccaggta
aaggaggaggccgtggtgcacgcctttcatgactgtgtccaggacttgatgaggacctgg
gaccactggtccatccacattttggacatcgttccctttctcaggttcttccccagcccc
ggcctacggaggctgaagcaggctgtggagagcagggaccacatggtggaggggcagctg
aggcggcaggaggagagcatggtgacaggccgctggcgggacgcgatggactacatgctg
cagggggtggggaagccgccggcccagcagggctccgggcagctcctcgaggggcacgtg
cacatgtctgtggtggacctgttcatcggcggcacctccaccacctcgaccaccctctcc
tgggccgtggcgtttttgcttcaccaccctgaggtcctgaggcgactgcaggaggagttg
gaccgtgagctgggccccggggcctggtgctccccagtcccctacaag

DBGET integrated database retrieval system