KEGG   Myotis davidii: 102775283Help
Entry
102775283         CDS       T02992                                 

Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
myd  Myotis davidii
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102775283
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    102775283
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102775283
Cytochrome P450 [BR:myd00199]
 Cytochrome P450, animal type
  CYP21 family
   102775283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 216 aa AA seqDB search
MMTVTRGYRCNAGNRHTGRGLPPVQRENTQTAQLIVFSEGPGAPLLTCSIICHLTFGDQV
KEEAVVHAFHDCVQDLMRTWDHWSIHILDIVPFLRFFPSPGLRRLKQAVESRDHMVEGQL
RRQEESMVTGRWRDAMDYMLQGVGKPPAQQGSGQLLEGHVHMSVVDLFIGGTSTTSTTLS
WAVAFLLHHPEVLRRLQEELDRELGPGAWCSPVPYK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtcacacggggctacaggtgtaacgcaggaaaccggcacaccggccgcggg
ctcccgcctgtgcagcgggagaacacacagaccgcgcagctcatcgtgttttcggagggt
cctggggcccctctcctcacctgcagcatcatctgtcacctcacctttggagaccaggta
aaggaggaggccgtggtgcacgcctttcatgactgtgtccaggacttgatgaggacctgg
gaccactggtccatccacattttggacatcgttccctttctcaggttcttccccagcccc
ggcctacggaggctgaagcaggctgtggagagcagggaccacatggtggaggggcagctg
aggcggcaggaggagagcatggtgacaggccgctggcgggacgcgatggactacatgctg
cagggggtggggaagccgccggcccagcagggctccgggcagctcctcgaggggcacgtg
cacatgtctgtggtggacctgttcatcggcggcacctccaccacctcgaccaccctctcc
tgggccgtggcgtttttgcttcaccaccctgaggtcctgaggcgactgcaggaggagttg
gaccgtgagctgggccccggggcctggtgctccccagtcccctacaag

DBGET integrated database retrieval system