KEGG   Mycobacterium sp. EPa45: AB431_24735Help
Entry
AB431_24735       CDS       T03960                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00071  Fatty acid degradation
mye00072  Synthesis and degradation of ketone bodies
mye00280  Valine, leucine and isoleucine degradation
mye00310  Lysine degradation
mye00362  Benzoate degradation
mye00380  Tryptophan metabolism
mye00620  Pyruvate metabolism
mye00630  Glyoxylate and dicarboxylate metabolism
mye00640  Propanoate metabolism
mye00650  Butanoate metabolism
mye00900  Terpenoid backbone biosynthesis
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye01130  Biosynthesis of antibiotics
mye01200  Carbon metabolism
mye01212  Fatty acid metabolism
mye02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mye00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB431_24735
   00630 Glyoxylate and dicarboxylate metabolism
    AB431_24735
   00640 Propanoate metabolism
    AB431_24735
   00650 Butanoate metabolism
    AB431_24735
  Lipid metabolism
   00071 Fatty acid degradation
    AB431_24735
   00072 Synthesis and degradation of ketone bodies
    AB431_24735
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB431_24735
   00310 Lysine degradation
    AB431_24735
   00380 Tryptophan metabolism
    AB431_24735
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB431_24735
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB431_24735
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AB431_24735
Enzymes [BR:mye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB431_24735
Exosome [BR:mye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB431_24735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III CUE
Motif
Other DBs
NCBI-ProteinID: AKK29344
UniProt: A0A0G3IR65
Position
complement(5237124..5238335)
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQRGGSLTEVKPLNLVVGLIDELRSRFPDLDETLISDVILGCVS
PVGDQGADIARTAVIAAGMPETVGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMFTDPATMFDNYIVPQGISADLIATMEGFSREDVDRYAERSQERAAA
AWSGGYFAKSVVPVKDQNGLVILDHDEHMRPGTTVESLGKLKSAFEGLAAMAGFDDVALQ
KYHWLEKINHVHTGGNSSGIVDGAALVLVGSEAAGKSQGLTPRARIVATATSGAEPTIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEILNVNGGAIAMGHP
LGATGAMITGTMVDELERRGAKRALVTLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgaaccccgcgcggcaagcagcgcggc
ggatcgctgaccgaggtcaagcccctgaacctggtggtcgggctgatcgacgagctgcgc
agccgctttcctgacctggacgagaccctgatcagcgacgtcatcctgggctgcgtctca
ccggttggcgaccagggcgccgacatcgcccgcaccgcggtgatcgcggccgggatgccc
gagaccgtcggcggcgtgcagctcaaccggttctgcgcctccggcctcgaagcggtcaac
accgccgcgcagaaggttcgctccggatgggacgacctggtgctcgccggcggcgttgag
tcgatgagccgcgttccgatgggttccgacggcggtgcgatgttcaccgacccggccacc
atgttcgacaactacatcgtgccgcagggcatcagcgccgacctgatcgcgacgatggag
ggtttctcccgcgaggacgtcgaccgctacgccgagcggtcccaggagcgggcggccgcg
gcctggtccggcggctacttcgccaagtccgtcgttccggtcaaagaccagaacggtctg
gtgatcctcgaccacgacgagcacatgcgtcccggcaccaccgtggaaagcctgggcaag
ctcaaatcggccttcgagggcctggccgcgatggccggcttcgacgatgtggcgctgcag
aagtaccactggctcgagaagatcaaccacgtccacaccggtggcaacagctccggcatc
gtcgacggcgccgcgctggtgctggtcggcagcgaggctgccggcaagtcgcaggggctc
accccgcgggcgcgcatcgtggccaccgccaccagtggtgccgagccgacgatcatgctg
accggcccgacgccggctacccgcaaggtgcttgaccgcgccggcctcaccgtcgacgac
atcgacctgttcgagctcaacgaggccttcgcgtcggtggtgctgaagttccagaaagac
ctgaacatcccggacgaaatcctgaacgtcaacggcggtgcgatcgcgatgggtcacccg
ctgggtgccaccggcgcgatgatcaccggcaccatggtcgacgagctggagcgtcgcggc
gccaagcgtgccctggtcacgctgtgcatcggcggcggcatgggcgtggccaccatcatc
gagagggtttaa

DBGET integrated database retrieval system