KEGG   Mycobacterium sp. NRRL B-3805: MyAD_22070Help
Entry
MyAD_22070        CDS       T05013                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00071  Fatty acid degradation
myn00072  Synthesis and degradation of ketone bodies
myn00280  Valine, leucine and isoleucine degradation
myn00310  Lysine degradation
myn00362  Benzoate degradation
myn00380  Tryptophan metabolism
myn00620  Pyruvate metabolism
myn00630  Glyoxylate and dicarboxylate metabolism
myn00640  Propanoate metabolism
myn00650  Butanoate metabolism
myn00900  Terpenoid backbone biosynthesis
myn01100  Metabolic pathways
myn01110  Biosynthesis of secondary metabolites
myn01120  Microbial metabolism in diverse environments
myn01130  Biosynthesis of antibiotics
myn01200  Carbon metabolism
myn01212  Fatty acid metabolism
myn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:myn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MyAD_22070
   00630 Glyoxylate and dicarboxylate metabolism
    MyAD_22070
   00640 Propanoate metabolism
    MyAD_22070
   00650 Butanoate metabolism
    MyAD_22070
  Lipid metabolism
   00071 Fatty acid degradation
    MyAD_22070
   00072 Synthesis and degradation of ketone bodies
    MyAD_22070
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MyAD_22070
   00310 Lysine degradation
    MyAD_22070
   00380 Tryptophan metabolism
    MyAD_22070
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MyAD_22070
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MyAD_22070
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MyAD_22070
Enzymes [BR:myn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MyAD_22070
Exosome [BR:myn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MyAD_22070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMO08588
Position
complement(4732680..4734209)
Genome map
AA seq 509 aa AA seqDB search
MVDPRTPVIVGVGQFTERIDDDGYRGMSSVELATEAARAAVADTGADSATIAAAIEVFVG
LRQFEICTPFSEAPLGCSDNYPRSVAARIGADPARAVLEPLGGHGSQKVTTEFAGVIAAG
DAEVVLVLGSENGSTLRHFAGREDKPDHSETIGGQLEDRGYGFDQYMNEYTATHGLTGAP
VQYGLLDNARRARIGATVADYRRQMAELFAPFSEVAAKNPLASSPVERTVDELATVTPEN
RMICDPYPRLMVARDQVNQGAAVLLMSVAAARRLSVPEEKWVYLHGHADLVEQSLLDRAD
LSASLSAEMAVAEALRVAEVELSEVSTFDLYSCFPFPVFSVCDSAGLAPDDPRGLTLTGG
LPFFGGPGNSYSLHGIAETVCSAREQPGRFGLVGANGGVMSKYSVGVYSTVPVDWRTDRS
RELQSRIDEQPMVAVTRHPEGRGTIETYSVRYDWPTTTGVIIGRLDADGSRFMALTTDED
LLALMADGDPLGAAITVTAGEKENHATLA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtggatccgcgtaccccggtgatcgtcggcgtgggacagttcaccgaacgcatcgat
gacgacggctaccgagggatgtcctcggtggagttggccaccgaggcggcccgggcggcg
gtggccgacaccggtgcggactcggcgaccatcgccgccgccatcgaggtcttcgtcggg
ctgcgccaattcgagatctgcacgccgttctccgaggcgccgctgggctgttcggacaac
tacccgcggtcggttgccgcacgtatcggcgccgaccctgcccgcgcggtgctggaaccg
ctcggcgggcacggatcgcagaaggtgaccaccgagttcgccggagtcatcgccgccggt
gatgccgaggtcgtgctggtgctgggatccgaaaacggttcgacactgcgccatttcgcg
ggccgcgaggacaagccggaccactccgagacgattggtggccagctggaggatcgtggc
tacggattcgaccagtacatgaacgagtacaccgccacccacggtctgacgggtgcgccc
gtgcagtacggactgctggacaacgcccgccgagcgcgcatcggtgccacggtggccgac
taccgccgtcagatggccgagctcttcgcgccgttctcggaggtcgccgccaagaacccg
ttggcgtcatcaccggtggaacggaccgtggacgaactcgccaccgtcacaccggaaaac
cggatgatctgtgacccttacccgcgcctgatggtggcccgcgaccaggtgaaccagggc
gccgcggtgctgttgatgtcggtggccgccgcacgccggctgtcggtgcccgaggagaag
tgggtatacctgcacggtcatgccgacctcgtcgaacaatccctgctcgaccgcgccgac
ctgagcgccagtctctcggcggaaatggctgtggcagaggcgcttcgcgtggccgaggtg
gagctttccgaggtatccaccttcgacctctacagctgcttccccttcccggtgttctcg
gtgtgcgactcggccggactggcgcccgacgacccgcgcggcctcaccctcaccggaggg
ctgcccttcttcggcggcccgggcaacagctactccctgcacggcatcgccgagacggtg
tgcagcgcccgggagcagccgggccgattcggcctcgtcggcgccaacggcggtgtgatg
agcaaatattcggtcggcgtgtactcgaccgtgccggtcgactggcgtaccgaccgcagc
cgggaactgcagtccaggatcgacgaacagccgatggttgcggtcacccggcaccccgaa
ggtcgcggcacgatcgaaacgtactcggtgcgttacgactggccgacgaccaccggggtc
atcatcggcaggctcgacgccgacggcagccggttcatggcgctgaccaccgacgaggat
ctgctcgccctgatggccgacggcgacccgctcggtgccgcgatcacggtgaccgcgggg
gagaaggagaaccacgccacgctggcgtga

DBGET integrated database retrieval system