KEGG   Mycobacterium yongonense: OEM_03150Help
Entry
OEM_03150         CDS       T02732                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
myo  Mycobacterium yongonense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OEM_03150
Enzymes [BR:myo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OEM_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(320361..321239)
Genome map
AA seq 292 aa AA seqDB search
MGVVVIGQIARDLVLRTDGPPTTDDSTTVLQRKELLGGKGANQAVGLAQLGVPAALIAVA
GDDDAGASVLAQAQRDGIDVGGVARRGTTALLIDVVPKPPERMLLEDVPESSLIQVADLD
RSVFDTADTVSIQLQQPPATALEAAQRARRRGLRVVADGAPAEHIRADLLAAVDVIRADA
TEASLIAGREIGTAAQARELADRLLTCGPGLVALAVPKVGDLVAWDGGSRLFEFADVDVV
DPTGAGDAFVAGLIAALRDGAAPPEAGELAAAAASATVQRLGGRPDLTALKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttgtcgtgatcggccagatcgcacgcgatctggtgctgcgtaccgatgggccg
ccgacgaccgacgattccaccacggtcctgcagcgcaaggagctgctgggcggcaagggc
gccaatcaggcggtcggcctggcgcagctgggtgtgccggccgccctcatcgcggtggcc
ggtgacgacgatgcgggggcgtcggtcctggcgcaggcccaacgggacggcatcgacgtc
ggcggcgtcgcgcgtcgcggcaccacggcgctgttgatcgatgtggtcccaaaaccgccg
gaacgcatgctcctcgaagacgtgcccgaaagctcgctgatccaagtcgccgacctcgat
cggtccgtgttcgacaccgccgacaccgtttccattcagctgcagcagccgccggccacc
gcgttggaagccgcgcaacgcgctcggcggcggggtctgcgcgtcgtggccgacggcgcg
cccgccgagcacattcgggccgacctgctcgcggcggtcgacgtgatccgcgccgacgcc
acggaagcctcgctcatcgcgggccgggagatcggcacggcggcgcaggcgcgcgagctg
gccgaccgcctgttgacctgcggtccgggactggtcgccctcgcggttccgaaggtcggt
gacctggtggcgtgggacggtggcagtcggctcttcgaattcgccgacgtcgacgtggtg
gatccgaccggcgcgggcgacgcgttcgtggccgggctgatcgccgcgctgcgtgatggc
gccgcaccaccggaggccggtgaacttgcggccgcggccgccagcgccaccgttcagcgc
ctcggcggccggcccgacctgaccgcgctcaaggcgtga

DBGET integrated database retrieval system