KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_05430Help
Entry
OEM_05430         CDS       T02732                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00360  Phenylalanine metabolism
myo00362  Benzoate degradation
myo00620  Pyruvate metabolism
myo00621  Dioxin degradation
myo00622  Xylene degradation
myo00650  Butanoate metabolism
myo01100  Metabolic pathways
myo01120  Microbial metabolism in diverse environments
myo01220  Degradation of aromatic compounds
Module
myo_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OEM_05430
   00650 Butanoate metabolism
    OEM_05430
  Amino acid metabolism
   00360 Phenylalanine metabolism
    OEM_05430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OEM_05430
   00622 Xylene degradation
    OEM_05430
   00621 Dioxin degradation
    OEM_05430
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OEM_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGP62079
UniProt: S4Z594
Position
537732..538646
Genome map
AA seq 304 aa AA seqDB search
MAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVDWLLAQS
DKPDLVFEATSAYVHREAAPKYEAAGIRAVDLTPAAVGPAVIPPANLRQHLDAPNVNMIT
CGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSKGVETIG
GAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVQTYVPGYRLLND
PQFDDPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLTATAG
GAQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcgtcgggtcgggcaacatcagcactgacctgctttacaagttgttgcgatcg
gactggctggagccgcgctggatggtcggcatcgaccccgaaagcgagggcctggcgcgg
gcccgcaagctgggtttggagaccacccacgagggcgtggactggttgctggcgcagtcg
gacaagcccgatctggtgttcgaggcgaccagcgcctatgtgcatcgcgaagccgcgccc
aagtacgaggccgccggcatccgggccgtcgacctgacgcccgccgcggtgggtcccgcg
gtgatcccgccggccaacctgcgccagcacctggatgcgcccaacgtcaacatgatcacc
tgcggcgggcaggccaccatcccgatcgtgtatgcggtgtcgcgcgccgtcgccgacctc
ggtggggtgccgtacgccgagatcgtcgcctcggtcgcctcgctgtcggcggggccggga
acccgggccaacatcgacgagttcaccaagaccaccagcaagggcgtggagaccatcggt
ggcgccaagcggggcaaggcgatcatcatcttgaaccccgccgatccgccgatgatcatg
cgcgacaccatcttttgcgccattcccgaggacgccgaccgcgacgcgatcgccaagtcc
atccacgacgtggtggccgaggtgcagacctacgttcccggctaccggctgctcaacgac
ccgcagttcgacgacccgtcgatcaactccggcggccaggcgctggtcaccacgttcgtc
gaagtcgagggggccggcgattacctgcccccctatgcgggcaacctggacatcatgacc
gccgcggctaccaaggtcggcgaggagatcgccaaggaatccttgaccgcgacggccgga
ggagcgcaatcatga

DBGET integrated database retrieval system