KEGG   Mycobacterium yongonense: OEM_09290Help
Entry
OEM_09290         CDS       T02732                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
myo  Mycobacterium yongonense
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEM_09290
   00330 Arginine and proline metabolism
    OEM_09290
   00340 Histidine metabolism
    OEM_09290
   00350 Tyrosine metabolism
    OEM_09290
   00360 Phenylalanine metabolism
    OEM_09290
   00380 Tryptophan metabolism
    OEM_09290
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     OEM_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904579..905892
Genome map
AA seq 437 aa AA seqDB search
MKVVVVGAGLGGLTAATRLSAAGHDVVVLEGRAEVGGRSRSRPVTGDVVELGAQFISTRH
RRMRKLVTDAGLHLARGRYAAGPVLWRQPNDRAGHLIPHLAPTDLIALARLPLGPRSLRW
LAAANRVELQRAELDAQSVADFFGHRCSASLRYFIECLIGALFGGAKLEDISLLSLAELL
GREGGTLRFVIGEVGGASHIVEGTGALATHLACRLTTPVHLQATVNAVEQDNSTVAAHVD
NGDVVEADHAIIAVPTPTLAGIKFTPSLPDTIDDANTGINYGRATKLVAIVPPRGPFQAQ
AFIGGNLITAGWRTRRVLYGFTTRIAAELDVETLADDLCRGFGVSPGLVEHAELVSWPED
RFTGGTYAHLLPGRFSQFRRSLPHRHRRVRFAGAERSSWPLFMEGAVESGEQAADSTIRA
SLQPRNCVTSPLNPSSK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtagtagtcgtcggagcaggacttggcggactcacagcggcaacacgtttgagt
gccgccggccatgacgtcgtcgttctcgagggccgcgccgaggtcggcggtcgctcgcga
tcccggcccgtcaccggcgacgtcgtcgagctcggcgcccagttcatttccacacgacat
cgacggatgcggaagctcgtaacagacgccggtctgcacctcgcccgcggccgttacgct
gcgggccccgtgctatggcggcagcccaatgaccgagcaggacatctgatcccgcacctt
gcgcccaccgatctcattgcactggcccgcctgcccctaggtccccgcagccttcgttgg
ctagccgccgccaacagagtggagcttcaacgcgccgaactcgacgcacaatccgtagcc
gacttcttcggccaccgatgttccgcctcgcttcggtacttcatcgaatgcctcatagga
gcactattcggcggcgccaaacttgaggacatctcgctgctgagtctcgccgaactgctt
gggcgcgaaggaggtacgctccgattcgttatcggagaagttggtggggcgagccacatc
gtagagggaaccggggcgctcgccacccacctcgcttgccggctcaccacgccggtgcac
ctacaagcaacagttaacgccgtcgagcaggacaacagcaccgtggcggcgcatgtcgac
aacggtgacgtcgtcgaggccgaccacgccatcattgcggtaccgacccccactctggcg
gggatcaaattcactcccagcttgccggacaccatcgacgatgcgaacactggcattaac
tacgggcgggctaccaagttggtggccatcgtcccaccacgagggcccttccaagctcag
gcattcatcggcggaaatctcatcaccgccggctggcgaaccagacgggtcctctacggc
ttcaccacgcgcatcgcagccgagctcgacgtcgagacgctcgccgacgatctgtgtcgc
ggcttcggggtcagtcccggcctcgtcgaacacgctgagctggtgtcgtggcccgaagat
cgctttaccggcggcacctatgcccacctattgccggggcggttcagccagttccgccga
tcactgccgcatcggcaccgccgcgtacgattcgccggcgccgaacgcagcagctggccg
ctgttcatggaaggcgcggtagaaagcggcgaacaagcggcggattcaaccattcgcgcg
tcactccaaccgcggaattgcgtgacatcgccactcaatccgtcatcgaaatag

DBGET integrated database retrieval system