KEGG   Mycobacterium yongonense: OEM_09540Help
Entry
OEM_09540         CDS       T02732                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
myo  Mycobacterium yongonense
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:myo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931942..932805
Genome map
AA seq 287 aa AA seqDB search
MPELPEIEALADHLRRNAVGLTVGRVDIAALSVLKTFDPPINALHGQTVVGADRWGKYLG
LRTDDLYLVAHLSRAGWLRWSDKLAAAPLRPGKGPIALRVHLGTPGEAPGFDLTEAGTQK
RLAVWLVSDPQQIPQIASLGPDALDLGPDDLARILAGNTGRIKTVITDQKVIAGIGNAYS
DEILHVAKISPFATAGKLSEKQLAALHDAMITVLTDAVSRSVGQGAATLKGEKRSGLRVH
ARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKVLADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaactgcccgagatcgaagcgctggccgatcatctacggcgcaacgccgtgggc
ctgacggtcggccgtgtcgacatcgccgccctgtccgtcctgaagaccttcgacccgccg
atcaacgcgctgcacggccagaccgtggtcggcgccgaccgctggggcaaatacctgggg
ctgcggacggacgacctctacctggtcgcccacttgtcccgggcgggctggttgcggtgg
tccgacaagctggccgcggcgccgctgcgccccggcaagggcccgatcgcgctgcgcgtg
cacctgggcacgcccggtgaggcgcccggcttcgacctcaccgaggccggcacccagaag
cggctggcggtgtggctggtaagcgacccgcagcagatcccacagatcgcctccctcggg
ccggacgcgctggacctcggccccgacgacctggcccgcattctggcgggcaacaccggg
cggatcaagaccgtcatcaccgaccagaaggtgatcgccggtatcggcaacgcctacagc
gacgagatcttgcacgtcgcgaagatctcgccgttcgccaccgccggcaagctgtccgag
aagcagctcgccgcgctgcacgacgccatgatcaccgtgctcaccgacgcggtgagccga
tccgtcggccagggcgcggccacgctcaagggcgagaagcgctccggattgcgcgtgcac
gcccgcacgggcctgccctgcccggtgtgcggggacaccgtgcgtgaagtgtcgttcgcg
gacaagtcttttcaatattgtccgacgtgtcagaccggaggcaaggtcctggccgaccgg
cggatgtcgcgtttgctgaagtag

DBGET integrated database retrieval system