KEGG   Mycobacterium yongonense: OEM_16010Help
Entry
OEM_16010         CDS       T02732                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
myo  Mycobacterium yongonense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OEM_16010
Enzymes [BR:myo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OEM_16010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641436..1642287)
Genome map
AA seq 283 aa AA seqDB search
MNIDLSLGVGALPRPGETVLASSMTQAPGGKGGNQAVAAARAGARVQFVGAVGDDPAAEQ
LRAHLRANGVGLDGAVEIPGPSGTAVVVVDANAENTIVVAPGANGRFTLTDDRARDVVAD
CDVMLTQLEIPVDTAIAAAQHARSAGAVVVVNASPAGQDPASLGELAAAADVVITNEEEA
NEWPWRPTHLVVTLGSRGARYAGADGEYSVPSPAVDAVDTTGAGDVFAGVLAANWPPNPG
SADERRLALRRACAAGALATLVPGAGDCAPDAEAIDKALQNAS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcgatctgtcgctgggcgtaggcgccctcccgcggcccggcgaaacggtgttg
gcgtcgtcgatgacacaagcccccggcggcaagggcggcaaccaggcggtggcagccgcg
cgcgcgggcgcgcgcgtgcagttcgtcggggccgtcggcgacgacccggccgccgagcag
ttgcgcgcccacctgcgggccaacggtgtcgggctcgacggggccgtggaaatccccggg
cccagcggcaccgccgtcgtcgtcgtcgatgccaacgccgagaacaccatcgtcgtggcg
ccgggagccaacgggcggttcacgctgaccgatgaccgcgcgcgcgacgtggtcgccgac
tgcgatgtgatgttgacccagctggagattccggtcgacacggcgatcgcggcggcgcaa
cacgcccggtcggccggagcggtcgtcgtagtgaacgcctcaccggccggccaggatccc
gcttcgctgggcgagctggcggccgccgccgacgtggtgatcaccaacgaagaggaagcc
aacgaatggccttggcgcccaacacacctggtggtcaccctgggttcacgcggcgcgcgc
tacgccggcgccgacggcgagtactcggtgccctcccccgcggtggacgcggtggacacc
accggcgccggcgacgtgttcgccggtgtgctggccgcgaactggccgcccaatcccggc
tcggcggatgagcggcgactcgcgctacgccgcgcctgcgcggccggcgcgctggcgacg
ctggttcccggcgccggtgattgcgcaccggacgccgaggcgatcgacaaggcgcttcag
aacgcgtcctag

DBGET integrated database retrieval system