KEGG   Mycobacterium yongonense: OEM_26130Help
Entry
OEM_26130         CDS       T02732                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
myo  Mycobacterium yongonense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OEM_26130
Enzymes [BR:myo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OEM_26130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2736815..2738998
Genome map
AA seq 727 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGRRVRVSETTLKAVLAALGVAAGDEQERNVALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLALEDGTVRGDVAQIDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRQSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPPGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
DQPRSAGRELSYAAFRDREGRALDDFATWCALAEKYGDDWHCWPEALQHPDASGVADFVE
KHSDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGAPPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDELGLLTRP
VAEELESDRAELAAWLAELRRVGLLDEGEDDPERVILALYKYLGRTPSRLLGLALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRDVLLEDVFTDPRAATLAEAVRAAIAPAASESSA
SVQSAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcaccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcaggcgggtgcgggtgtccgagacgacactcaaggccgtgctg
gccgcgctcggcgtcgcggccggcgacgaacaggaacgcaacgtcgcgctcaccgccaag
ctgcggtcgcactgggcgcggcggctgccggcgaccatcgtcgggcgcaccggtgagcag
attcggttttgggcccacgtcacccacggtgctcccgccgaggtgtggttggcgctcgag
gacggcacggtgcgcggcgacgtcgcgcagatcgacaacttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgatctgccgctggggtat
caccgggtgcacctgcgctccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcagtcctggggcgtcggggatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattacctcctggtcaatccgttgcat
gcggcggcgcctccgggtccgaagggccggatggagccgtcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaccaaccgcggtcggcggggcgggagctgtcctacgcggcgttccgcgaccgggagggc
cgcgcgctcgacgacttcgcgacctggtgcgcgctggccgaaaaatacggcgatgactgg
cattgttggcccgaagcgctacaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattccgacaccgtcgatttccaccgctggttgcaatggcagatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggagacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggggcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccctttcgcgcgttgatc
cgcgcggtgctgcggcatgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggtgcaccacccaccgagggcacctacgtccgctacgaccac
gaagccatgatcggcatcgtcgctctggaggcgcaccgggccggcgcggtggtggtgggc
gaggacctcggcacggtcgagccgtgggtgcgtgactacctgttgttgcgcgggctgctg
ggcacgtcgattctctggttcgagctggaccgcgacgggaacggcggaccactgccggcc
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgacggcc
ggctacctggcgggcgaccatgtgcggctgcgtgacgagctgggtttgctgacccggccc
gtcgccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgc
cgggtggggctgctcgatgaaggcgaagacgacccggagcgggtcatcctggcgctgtac
aagtacctgggccggacgccgtcgcggctgctggggctggcgctcaccgacgccgtcggt
gaccgccgcacccagaaccagcccggcaccacggacgaataccccaactggcgggtcccg
ctgaccggcccggacgggcgcgacgtcctgctcgaagacgtgttcaccgatccccgggcc
gccacgctggccgaggccgtgcgcgccgcgatcgccccggccgcctcggaaagctcggcc
agcgttcaaagcgcggcccgctga

DBGET integrated database retrieval system