KEGG   Mycobacterium yongonense: OEM_27040Help
Entry
OEM_27040         CDS       T02732                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
myo  Mycobacterium yongonense
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    OEM_27040
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     OEM_27040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2832774..2834240
Genome map
AA seq 488 aa AA seqDB search
MIAESDVTPVAASSITSWDAEADVVIAGYGIAGAAAAVEAARSGADVLVLERTGSWGGAA
SMAGGFIYLGGGTPLQKACGFSDSVENMAAFLNVAMGPGADEARIADYCAGSVAHFDWLV
GCGVPFKAEFFSEPGWEPMGDQGLMYSGGENSYPFNTIASPAPRGHVPQMQNKKQGEASA
GYMLMKPLVETATAAGARALYDVRVQRLITESDGRVVGVCARQYGNDMTIRARRGVVLAT
GSFAYNDAMVARYAPRIAGRPAASIEQHDGQAIRMAQALGADLAHMDATEVAIFVDPQQL
VRGILVNGRGQRYVAEDTYPGRIGQLTLYQQDNVAYLIIDGDAQEEAEASWSPKLMLRPA
TWVADTVADLERDMGLPPGSLQATVAAYNEGAARGEDPLLHKKSEWIKPIGSPVGAIDLR
ESTGGFTLGGLATTLDAEVLHVSGAPIPGLFAAGRCTAGLAAWGYASGVSLGDGSFYGRR
AGRSAAKA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgaatctgacgtgacgccggtggcggcgtcgtcgatcacgtcgtgggacgcc
gaggccgacgtcgtcatcgccggctatgggatcgcgggcgccgcggcggcggtggaagcc
gcccggtccggtgctgacgtcctggtgctcgagcgcaccggatcctggggtggcgcggca
tcgatggcgggcggattcatctacctcgggggcggcacgccgctgcaaaaggcttgcggc
tttagcgattcggtcgagaacatggcggcgttcctcaacgtcgcgatgggccccggcgcc
gacgaggccaggatcgccgactattgcgccggcagcgtcgcccacttcgactggctggtg
ggctgcggcgtcccgttcaaggcggagttcttctccgagccgggctgggagcccatgggc
gaccaggggttgatgtacagcggcggcgaaaactcctatccgttcaacacgatcgcctcc
cccgccccgcgcgggcacgtcccgcagatgcagaacaagaagcagggcgaagcgagcgcg
ggctacatgctgatgaagcccctcgtcgaaacggccaccgccgccggggcgcgggccctc
tacgacgtgcgggtgcagcggctgatcaccgaatccgatggccgggtggtgggcgtctgc
gcccgccagtacggcaacgacatgacgatccgggcgcgccgcggggtcgtgctcgccacc
ggcagtttcgcctacaacgacgcgatggtggcgcgctacgcgccgcgcatcgcggggcgg
ccggccgcgtcgatcgagcagcacgacggccaggcgatccggatggcgcaggcgctgggc
gccgacctggcgcacatggacgccaccgaggtcgcgatcttcgtcgacccccagcagctg
gtgcgcggcatcctggtcaacgggcgcggtcagcgctacgtcgccgaggacacctatccg
gggcggatcggccagctcacgctgtaccagcaggacaacgtcgcgtacctgatcatcgac
ggtgacgcgcaggaggaggcggaggcctcgtggtcgccgaagctgatgctgcgcccggcg
acctgggtggccgacaccgtcgcggacctggagcgcgacatgggcctgccccccggttcg
ctgcaggccaccgtggcggcctacaacgagggcgccgcgcgcggcgaggatccgctgctg
cacaagaagtccgagtggatcaagccgatcggatcgccggtcggcgcgatcgacctgcgg
gaaagcaccggcggcttcaccctgggcgggctggcgaccacgctggacgccgaggtgctg
cacgtcagcggcgcgcccatacccgggctgttcgccgccggccggtgcaccgccggcctg
gccgcgtggggctacgccagcggcgtctcgctcggtgacggcagcttctacggccgccgc
gccgggcgctcggccgctaaggcctga

DBGET integrated database retrieval system