KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_28340Help
Entry
OEM_28340         CDS       T02732                                 

Definition
(GenBank) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00350  Tyrosine metabolism
myo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    OEM_28340
Enzymes [BR:myo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     OEM_28340
Exosome [BR:myo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OEM_28340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25 DUF531 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: AGP64369
UniProt: S4ZBQ3
Position
3007908..3008657
Genome map
AA seq 249 aa AA seqDB search
MDLKRRIPLLRWSVWRMAVGNRNITTTGQIGDGREAAAVEYVLRNARAGDVDDVLATIDK
FAYEESMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPNAKVFSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALAEHGFAAGTLDFVFLDHDKDAYL
DDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLEYQSLVSD
LVLESEYLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaagcgacggatacccctgctgcggtggtcggtctggcggatggccgtcggg
aatcgcaacatcaccaccacgggccagatcggtgacgggcgcgaggcggccgccgtcgag
tacgtcctgcgcaacgcccgggcgggcgacgtcgacgacgtgctggccaccatcgacaag
ttcgcctacgaggagtcgatgctgatcaacgtcggcgacgagaaggggctgctgctcgac
gccgccgtgcggcgcgccgatccggcgctggcgctcgaattgggcacctactgcggctac
ggcgcgctgcgcatcgcccgggccgcgccgaacgccaaagtgttctcggtcgaactcgcc
gaggccaacgccgccaacgcccgccagatctgggcgcatgccggcgtggccgaccgtgtg
acctgtgtggtcggcaccatcggcgacggtggccgcaccctggatgcgctggccgaacac
gggtttgccgctggcacactcgatttcgtgttcctcgatcacgacaaggacgcctacctc
gacgacctgaagagcatcctggatcggggctggctgcatcccggttcgatcgtggtcgcc
gacaatgtgcgggtgccgggcgcaccgaagtaccgcgggtacatgcaccggcatcagggc
acgcggtggaacaccgtcgagcacaagacccacctcgagtaccagtcgttggtgtccgac
ctggtgctggagtccgaatacctgggctag

DBGET integrated database retrieval system