KEGG   Mycobacterium yongonense: OEM_33740Help
Entry
OEM_33740         CDS       T02732                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
myo  Mycobacterium yongonense
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OEM_33740
  Amino acid metabolism
   00380 Tryptophan metabolism
    OEM_33740
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     OEM_33740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3636893..3637834)
Genome map
AA seq 313 aa AA seqDB search
MSGGLTPDQAIEAIRGAGGARPGCRALHAKGTLYRGTFTAARDAVMLSRASHLDGSPVPA
LIRFSNGSGNPKQRDGRPGVRGMAVKFTLPDGSTTDVSTQTARLFVSSTPDGFIDLLKAM
RPGLTTPLRMGKHLLTHPRLLGALPILREANRIPASYATTEYHGLHAFRWVAADGSARFV
RYHLVPIAAEEYLSVSDAHGKDPDFLTDELATRLDSGPVRFDFRVQIAGPTDSTVDPSSA
WQSTQIVTVGSLQITGLDTEREHGGDIVVFDPMRVTDGIEPSDDPVLHFRTLAYSASVKL
RTGVERGAEAPPA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtggattaacccctgaccaagcgatcgaggcgatccggggcgccggcggcgct
cggccgggctgccgcgcgttgcatgcgaagggcaccctgtaccggggcacgttcaccgcg
gcccgcgacgcggtaatgctctcgcgcgcaagccatctcgacggctcgccggtgccggcg
ctgatccggttctccaacggatcgggcaacccaaagcagcgcgatggccggcccggcgtg
cgtgggatggcggtgaagttcaccctgcccgacggctccaccaccgacgtctcgacgcag
accgcccggctcttcgtctccagcacgccggacggcttcatcgatctgctcaaggcgatg
cggcccggcctgacgacgccgctgcgcatgggcaagcacctgctcacccacccgcggctg
ctcggcgcgttgcccatcctgcgggaggccaaccggatcccggcgagctatgccaccacc
gaataccacggcctgcacgcgttccgctgggtcgccgccgacggcagcgccagattcgtt
cgctaccacctggttccgatcgcggccgaggagtacctgtcggtgtcggacgcccacggc
aaggatccggacttcctcaccgacgagctggcgacgcggctggactctgggccggtgcgg
ttcgacttccgggtgcagatcgccgggcccaccgactccacggtggacccgtcgtcggcc
tggcagagcacccagatcgtcaccgtcggctccctgcagatcaccggtctggacaccgag
cgcgaacacggcggcgacatcgtggtgttcgacccgatgcgggtgaccgacggcatcgaa
ccctccgacgatccggtcctgcatttccggacgctggcctattcggcgtcggtcaagctg
cgcaccggggtcgagcgcggcgccgaagccccgcccgcctga

DBGET integrated database retrieval system