KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_34410Help
Entry
OEM_34410         CDS       T02732                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00860  Porphyrin and chlorophyll metabolism
myo01100  Metabolic pathways
myo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OEM_34410
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     OEM_34410
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     OEM_34410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AGP64976
UniProt: S4ZC24
Position
complement(3695801..3697177)
Genome map
AA seq 458 aa AA seqDB search
MTSRSYCVVGGGISGLTAAYRLRMSLGDDAAITLFDPGERLGGILRTELVGGAPMDLGAE
AFVLRRPELPALLDELNLTGRQVVSTGARPLIYSGQRLRPLPTGTVVGIPSSAASVAGLV
DKATVARIDAEPSRPLEWVAGSDPAVADLVGDRFGDQVVSRSVDPLLSGVYAGSAATIGL
RAAAPTVAAALDRGAASLTDAVGRVLPPATGAPVFGALDGGYRVLVEELAARARARWVRA
AASRLERADAGWAVFDDTGARWLADAVILAVPVHESCRLLGGIAPRSVAAAGRITSASSV
VLALAVPADTAFPDCSGVLVATGERLRAKAITLSSRKWGARADVQLLRLSFGRFGDHVAA
STSDDELLAWALGDVATVFGLDIDPVDVRVQRWIDAMPQYGPGHADLVAEVRAGLPPTLA
VAGSYLDGIGVPACVGAAGRAAEDVIRAIGGPDPQVAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccgctcgtattgcgttgtcgggggcgggatttcggggctgacggcggcctac
cggctgcgcatgtccctcggcgacgacgcggccatcacgctgttcgacccgggggagcgg
ctcggcgggatcctgcgcaccgagctggtcggcggggcgccgatggatctgggcgccgag
gcgttcgtgctgcgccgacccgagctgccggcgctgctggacgagctgaatctgaccggg
cgccaagtggtttcgaccggcgcccgcccgctgatctacagcgggcaacggctgcgcccg
ctgcccaccggcacggtcgtgggcatcccgtcgtcggcggcgtcggtggcgggattggtc
gacaaggcgaccgtcgcccgcatcgacgccgaaccctcccgcccgttggagtgggtcgcc
ggcagcgaccccgcagtggccgacctggtgggcgaccggttcggcgaccaggtggtctcg
cggtcggtggacccgctgctgagcggggtctacgcgggctcggcggccaccatcggcctg
cgtgcggccgcgccgaccgtggccgcggcgctggaccgtggcgccgccagcctgaccgac
gccgtcgggcgggtcctgccgccggccaccggcgcgccggtgttcggcgcgctcgacggc
gggtaccgggtgctggtcgaggagctcgccgcgcgcgcccgggcgcgctgggtgcgcgcc
gccgcgtcgcggctcgagcgcgccgacgcgggctgggcggtgttcgacgacaccggcgcc
cgctggctcgccgacgcggtgatcctggccgtccccgtgcatgaatcgtgccgcctgctc
ggcggcatcgcgccccgcagcgtcgccgcggccgggcgcatcaccagcgcatcgtcggtg
gtgctggcgctggccgtgccggctgacaccgcgttccccgactgttcgggcgtgctggtg
gccaccggggagcggttgcgggccaaggccatcacgctgtcgtcccgcaagtggggcgcg
cgggccgacgtgcagctgttgcggttgtcgttcgggcggttcggcgaccacgtggcggcc
agcacctccgacgacgagctgctggcctgggcgctgggggatgtggccacggtgttcggg
ctcgacatcgaccccgtcgacgtccgggtgcagcgctggatcgacgccatgccgcagtac
ggccccggccatgccgacctggtcgccgaggtgcgcgccggcctgccgccgacgctcgcg
gtggcggggagctacctcgacggcatcggcgtgcccgcctgcgtcggcgcggccgggcgc
gcggccgaggatgtgatcagggccatcggaggcccggacccgcaagtggcacgatag

DBGET integrated database retrieval system