KEGG   Mycobacterium yongonense: OEM_39620Help
Entry
OEM_39620         CDS       T02732                                 

Definition
putative flavin-containing monoamine oxidase AofH
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
myo  Mycobacterium yongonense
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEM_39620
   00330 Arginine and proline metabolism
    OEM_39620
   00340 Histidine metabolism
    OEM_39620
   00350 Tyrosine metabolism
    OEM_39620
   00360 Phenylalanine metabolism
    OEM_39620
   00380 Tryptophan metabolism
    OEM_39620
Enzymes [BR:myo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     OEM_39620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4207338..4208684
Genome map
AA seq 448 aa AA seqDB search
MSKPPRIVDVVVVGAGFAGLAAARELNRQGHDVVVFEGRDRVGGRSLTGNVAGLPADLGG
TFVGPTQDAVLAMAAELDVPTTPTHHDGKNLIHWRGWTHAYRGTIPKLSLTGLLDIGRLR
WQFDRIARGVPLAAPWDARRARELDGLSLGGWLRSVRATASSRDLLAIVARVTWGCEPDD
VSMLHAARYAHAAGGLDRLLDVEDGAQQDRFPGGTQQIAEAAAAELDTRVVLGAPVRRIE
RHGAGVTVTTDVGETEAGFVIVAIPPAHRASIEFTPPLPAEYEQLARHWPQGRLSKAYAA
YSTPFWRANGFSGQALSDRGPVFITFDVSPHPDGPGILMGFVDARAFDSLPGDQRRRDVL
RCFATLFGDDALKPLDYVDHRWGAEEFAPGGPTAAVPPGSWTRFGRWLREPVGPIHWAGT
ETADEWTGFLDGAIRSGQRAAAEITALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagccgccccggatcgtcgacgtcgtcgtggtcggagcgggctttgccgggctc
gccgccgcgcgcgagctcaaccggcagggccacgacgtggtggtcttcgagggccgcgac
cgggtcggtgggcggtcgctgaccggcaacgtcgccggattgccggccgacctgggcggc
actttcgtcgggccgacccaagacgccgtgctggcgatggcggccgaactcgacgttccc
accacgcccacgcaccacgacggcaagaatctgatccactggcgcggctggacgcacgcg
tatcgcggcaccattcccaagctgtccctgaccggcctgctggacatcggccgactgcgc
tggcagttcgaccggatcgcccgcggcgtcccgctggcggccccgtgggacgcccgccgg
gcgcgcgaactcgacggcctgtcgctcggcggctggctgcgctcggtgcgggcaaccgcc
tcgtcgcgcgacctgctggcgatcgtggcgcgggtgacctgggggtgcgagcccgacgac
gtgtcgatgctgcacgccgcccgctacgcgcacgcggccggcggcctggaccgactgctc
gacgtcgaggacggcgcccaacaggaccgctttcccggcggcacgcaacagatcgcggag
gccgcggccgccgaactggacacgcgagtggtgctgggcgcaccggtgcggcgcatcgaa
cgccacggtgcgggcgtgaccgtgacgaccgatgtcggcgagaccgaggccggcttcgtc
atcgtcgcgatcccgccggcccatcgcgcctcgatcgagttcactcccccgctgcccgcc
gagtacgagcagctcgcccggcattggccccagggccggctgtccaaggcgtacgcggcc
tattccacgccgttttggcgggccaacggcttttccgggcaggcgctgtccgaccggggc
cccgttttcatcacgttcgacgtcagcccgcacccggacggtccgggcatcctcatgggt
ttcgtcgacgcccgcgcgttcgactcactgcccggcgaccagcgccgtcgcgacgtgtta
cgttgctttgcaacgcttttcggtgacgacgcactcaaaccgctcgactacgtcgatcat
cgttggggcgcagaggaattcgcgccgggcggcccgaccgcggcggtgccgccggggtcg
tggacgcggttcgggcggtggctgcgcgaaccggtcggcccgatccactgggcgggcacc
gagaccgccgacgaatggaccgggttcctcgacggggcgatcaggtccggccagcgtgcg
gccgccgagatcaccgcgctgctatga

DBGET integrated database retrieval system