KEGG   Mycobacterium yongonense: OEM_39690Help
Entry
OEM_39690         CDS       T02732                                 

Definition
catalase HPII (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
myo  Mycobacterium yongonense
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:myo00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:myo00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4216099..4218201
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLESARFRRDTGYLTTQQGVRVDHTDDSLSVGERGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDSLAQYTAARFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVALQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNTIGGGCPALADE
NVFRHYTQRLDGQTMRKRAESFENHYSQARMFWMSMTRVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVL
AANGVDVVGTQRFIELMGQLGAVVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSDDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgcgacctggaatccgcacggttccgccgcgac
acgggatacctgacgacccagcagggcgtgcgcgtcgaccacaccgacgattcgctgtcg
gtcggtgagcggggaccgacgctgctggaggactttcacgcccgcgagaagatcacccac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggtgccggcgcctacggc
tatttcgaaccgtacgacgactcgttggcgcagtacaccgcggcgagattcttgaccact
ccaggtttgcagaccccggtgttcgtgcgattctccacggtggccggctcgcggggttcg
gccgacaccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaat
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaaattcccc
gatttcgtgcacgcggtgaaaccggagccgcacaacgagattccgcaggcacagtcggcc
cacgacacgctctgggacttcgtggcgctgcagcccgagacgctgcacaccatcatgtgg
ctgatgtcggaccgggcattgccccgtagctaccggatgatgcagggcttcggcgtgcac
accttccggttggtaaacgaccgcggcgagggcactttcgtgaaattccactggaaaccg
cggctcggcgtgcactcactgatctgggacgaatgccaaaagatcgccggcaaggacccc
gattacaaccgccgcgacctgtgggaggccatcgagtcgggccagtacccggagtgggag
ctcggcgtccagctcgtgcccgaggaggacgagttcagcttcgatttcgaccttctcgac
gcgacgaaaatcattcccgaggaacaggttccggtgcgcccggtgggcaagatggtgttg
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgttccacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccactgttgcagttccgcaacttctcttac
ctggacacccaactgatccggctgggcggccccaacttcgcccagctgccgatcaaccgg
ccggtggccgaggtccggaccaaccagcacgacggctacgggcagcacgcgattccgcag
ggccgctccagctactacaagaacaccatcggcggcggctgcccagcgctggccgacgag
aacgtgttccggcactacacccagcgcctcgacgggcagactatgcgtaagcgggccgag
tccttcgagaatcactacagccaggcgcggatgttctggatgagcatgacgcgcgtggag
gccgaacacatcgtcgcggcgttcgctttcgagctcggcaaggtggagatgcccgagatc
cgttcggcggtggtggcacagctcgcgcgggtcgacggcgaattggccgcccaggtggcc
gcgaagctggggcttcccgcgccgcccgaggagcaggtcgacacggtgaccgcctcaccg
gcgctgtcacaggtcaccgacgccggcgacaccatcgaatcgcgcaaggtcgccgtgctg
gccgccaacggcgtcgatgtggtggggacacagcgctttatcgagctgatgggacagctc
ggggcggtggtcgaggtgttggcgccggtggccggcggcacgctcgagggcggatccgga
ggcgaacttcccgtcgaccggtccttcacgacgatggcctcggtgctctacgacgcggtc
gtggtggcgtgcgggccgcggtcgatcgcgacgctgtccgacgacgggtatgcggtgcac
ttcgtgaccgaggcctacaagcatctcaagcccatcggggcgtacggcgccggcgtcgac
ctgttgcgcaccgccggcatcaccaaccgcctcgccgaggacaccgacgtgctcaacgac
cagtccgtcatcaccaccaaggccgccgccgacgagttgcccgatcgcttcgtcgaggaa
ttcgccggcgcgctcgcccaacaccgttgctggcaacggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system