KEGG   Mycobacterium yongonense: OEM_41900Help
Entry
OEM_41900         CDS       T02732                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
myo  Mycobacterium yongonense
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OEM_41900
Enzymes [BR:myo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     OEM_41900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4442381..4443664)
Genome map
AA seq 427 aa AA seqDB search
MPPAFDAPTVIRTKRDGGRLSDAAIDWVVDAYTAGRVAEEQMAALLMAILLRGMDRGETA
RWTSAMLASGERLDFSDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLESIAGFTAALSGRRVRDQLRDLGAAIFAAGDLAPADAKLYALRDVTATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGAFTDSETQSRDLASTMVALGAAHGVPTRALLT
DMNTPLGATVGNALEVAESLEVLAGGGPPDVVELTLRLACEMLELAGVDGRDPAETLRDG
TAMDRFRQLVAAQGGDLSVPLPIARHAETVTAARGGTMGDIDAMAVGLAAWRLGAGRSRP
GDRVQFGAGIRLHRRPGEPVTAGEPLFTLYTDTPERFGAALAELDGAFSVGDAAPASRPL
IIDRIAQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgccttcgatgcgcccacggtgatcaggaccaagcgcgacggcggccggttg
tccgacgccgccatcgactgggtcgtcgacgcctacaccgccggccgggtggccgaggag
cagatggcggccctgctgatggcgatcctgttgcggggcatggatcgcggcgagacggcc
cggtggacgtcggcgatgctggcctcgggcgagcggctcgacttcagcgacctcggcgtg
cccacggtcgacaaacactcgaccggcggggtgggggacaagatcaccctgcccctggtg
cccgtcgtcgccgcgtgcggcgccgcggtgccgcaggcgtcgggccgcgggctcggccac
accggcggcacgctggacaagctggaatccatcgccggattcaccgccgcgctgtccggc
cggcgggtgcgcgaccaactgcgcgacctcggcgcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacgtcaccgccaccgtcgagtcgctg
ccgctgatcgccagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggatccggggcattcaccgactcggaaacgcagtcccgcgacctg
gcgagcaccatggtcgcgctgggcgccgcgcacggggtgcccacccgcgcgctgctgacg
gacatgaacaccccgctgggcgcgaccgtcggcaacgccctcgaggtcgccgagtcgctc
gaggtgctggccgggggcgggccgcccgacgtcgtcgagctgacgctgcggctggcctgc
gagatgctcgagctggccggggtcgacggccgcgatcccgccgagacgctgcgggacggc
accgcgatggaccggtttcgccagctcgtcgccgcccagggcggcgatttgtcggtgccg
ctgccgatcgctcggcatgccgagaccgtgaccgccgcccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggagcgggcagatcccgtccg
ggcgatcgcgtgcagttcggcgccggcatccggctgcaccgccgccccggcgagccggtc
acggccggtgagccgctgttcaccctctacaccgacaccccggagcgcttcggcgcggcg
ctcgccgagctggacggcgccttcagcgtcggcgacgccgctccggcttcgcgtccgctg
atcatcgatcggatcgcgcaatga

DBGET integrated database retrieval system