KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_43530Help
Entry
OEM_43530         CDS       T02732                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00051  Fructose and mannose metabolism
myo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OEM_43530
Enzymes [BR:myo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OEM_43530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGP65888
UniProt: S4ZEC2
Position
4608082..4608735
Genome map
AA seq 217 aa AA seqDB search
MKFVENAETAVLDAAKDMLRRGLVEGTAGNISARRADGNIVITPSSVDYRDMQLDDLVLV
DPGGSVLQAADGRSPSSEMQLHLACFSAFDDIGSVIHSHPVWATMFAIAHEPIPACIDEF
AVYCGGDVRCTDYAASGTPDVGTNAVAALDGRAAALIANHGLVAVGPRPDKVLHVTALVE
RTAQIVWGARALGGPVPIPEDVNRNFAAVYGYLRANA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtcgagaacgcggagaccgcggtgctggacgcggccaaggacatgctgcgt
cggggcctggtggagggcaccgccggcaacatctcggcgcgccgcgccgacggcaacatc
gtcatcacgccgtcgtccgtcgactaccgcgacatgcagctcgacgacctcgtgctggtc
gatccgggcggctcggtgctgcaggcggccgacggccggtcgccgtcctcggagatgcag
ctgcacctggcctgcttttccgccttcgacgacatcggcagcgtcatccacagtcatccg
gtgtgggcgaccatgttcgcgatcgcccacgagccgatcccggcgtgcatcgacgagttc
gccgtgtattgcggcggggacgtccggtgcaccgactacgccgcgtccgggacccccgac
gtgggcaccaacgcggtcgccgcgctcgacggccgcgccgccgccctgatcgccaaccac
ggcctggtggcggtgggaccgcggccggacaaagttttgcatgtcaccgcgctggtcgag
cgcacggcccaaatcgtgtggggcgcacgggctctcggaggaccggtgcccatccccgag
gacgtcaatcgcaacttcgccgccgtctacgggtatctgcgggccaacgcctga

DBGET integrated database retrieval system