KEGG   Mycobacterium yongonense: OEM_47350Help
Entry
OEM_47350         CDS       T02732                                 

Definition
aminotransferase AlaT (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
myo  Mycobacterium yongonense
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    OEM_47350
   01230 Biosynthesis of amino acids
    OEM_47350
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OEM_47350
   00290 Valine, leucine and isoleucine biosynthesis
    OEM_47350
Enzymes [BR:myo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     OEM_47350
    2.6.1.66  valine---pyruvate transaminase
     OEM_47350
Amino acid related enzymes [BR:myo01007]
 Aminotransferase (transaminase)
  Class I
   OEM_47350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4988748..4990052
Genome map
AA seq 434 aa AA seqDB search
MDSDGTIGDVTTHQLPHQLPPHPSAHHRQQRTFAQSSKLQDVLYEIRGPVHQQAARLEAE
GHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGF
PRFDVDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDE
TQGWQPDIADMESKITDRTKALVVINPNNPTGAVYTSEVLTQIVELARKHELLLLADEIY
DKILYGDAKHINLASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINL
LANMRLCPNVPAQHAIQVALGGYQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPDG
ALYAFPRLDPEVYDIDDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAA
AIERLGNFLVAYRQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtgatgtgaccacccaccagctgccccatcagctgcca
ccgcacccgtcggcccaccaccggcagcagcgcactttcgcgcagtcgtcgaagcttcag
gacgtcctgtacgagatccgcggcccggtacatcagcaggccgcgcggctggaggccgag
ggtcatcgcatcctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgccc
gacgtgatcatgcgcgacatgatccaggccctcccgtacgcgcagggttactccgactcg
cagggcatactgccggcccgccgcgcggtggtcacccgctacgagttggtcgacggattc
ccccgcttcgacgtcgacgacgtctacctgggcaacggggtctccgagctgatcacgatg
acgctgcaggccctgctcgacaacggtgacgaggtgctgatcccgtcacccgactacccg
ctgtggacggcgtcgacgtcgctggcgggcggcaccccggtgcactacctgtgcgacgag
acgcagggctggcagcccgacatcgccgacatggagtccaagatcaccgaccgcaccaag
gcgctggtggtgatcaacccgaacaacccgaccggcgcggtgtacaccagcgaagtgctc
acgcagatcgtcgaattggcacgcaagcacgagctgctgctgctcgccgacgagatctac
gacaagatcctctacggcgacgccaagcacatcaacctggcctcgctggcgccggacatg
ttgtgcctgacgttcaacgggctgtccaaggcctaccgcgtggccgggtatcgggccggc
tggctggcgatcaccgggcccaaggaccacgccggcagcttcatcgaggggatcaacttg
ctggcaaacatgcggctgtgccccaatgtcccggcgcagcacgcgatccaggtcgccctc
ggcggctaccagagcatcgacgacctcgtcctgcccggcggccggctgctcgagcagcgc
gacgtcgcctggaccaagctcaacgagattccgggggtgtcctgcgtcaagccggacggc
gctctctacgccttcccgcgtctggaccccgaggtctacgacatcgacgacgacgagcag
ctcgtcctcgatttgctgctgcaggagaagattctggtcacccagggcaccggcttcaat
tggcccgcaccggatcacctgcgcatcgtgaccctgccgtgggcccgcgatctggcggcg
gccatcgagcggctgggcaacttcctcgtcgcctatcgccagtaa

DBGET integrated database retrieval system