KEGG   Mycobacterium yongonense: OEM_47350Help
Entry
OEM_47350         CDS       T02732                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
myo  Mycobacterium yongonense
Pathway
myo00220  Arginine biosynthesis
myo00250  Alanine, aspartate and glutamate metabolism
myo00290  Valine, leucine and isoleucine biosynthesis
myo01100  Metabolic pathways
myo01110  Biosynthesis of secondary metabolites
myo01130  Biosynthesis of antibiotics
myo01210  2-Oxocarboxylic acid metabolism
myo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OEM_47350
   00290 Valine, leucine and isoleucine biosynthesis
    OEM_47350
   00220 Arginine biosynthesis
    OEM_47350
Enzymes [BR:myo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     OEM_47350
    2.6.1.66  valine---pyruvate transaminase
     OEM_47350
Amino acid related enzymes [BR:myo01007]
 Aminotransferase (transaminase)
  Class I
   OEM_47350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGP66270
UniProt: S4ZI67
Position
4988748..4990052
Genome map
AA seq 434 aa AA seqDB search
MDSDGTIGDVTTHQLPHQLPPHPSAHHRQQRTFAQSSKLQDVLYEIRGPVHQQAARLEAE
GHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGF
PRFDVDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDE
TQGWQPDIADMESKITDRTKALVVINPNNPTGAVYTSEVLTQIVELARKHELLLLADEIY
DKILYGDAKHINLASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINL
LANMRLCPNVPAQHAIQVALGGYQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPDG
ALYAFPRLDPEVYDIDDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAA
AIERLGNFLVAYRQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtgatgtgaccacccaccagctgccccatcagctgcca
ccgcacccgtcggcccaccaccggcagcagcgcactttcgcgcagtcgtcgaagcttcag
gacgtcctgtacgagatccgcggcccggtacatcagcaggccgcgcggctggaggccgag
ggtcatcgcatcctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgccc
gacgtgatcatgcgcgacatgatccaggccctcccgtacgcgcagggttactccgactcg
cagggcatactgccggcccgccgcgcggtggtcacccgctacgagttggtcgacggattc
ccccgcttcgacgtcgacgacgtctacctgggcaacggggtctccgagctgatcacgatg
acgctgcaggccctgctcgacaacggtgacgaggtgctgatcccgtcacccgactacccg
ctgtggacggcgtcgacgtcgctggcgggcggcaccccggtgcactacctgtgcgacgag
acgcagggctggcagcccgacatcgccgacatggagtccaagatcaccgaccgcaccaag
gcgctggtggtgatcaacccgaacaacccgaccggcgcggtgtacaccagcgaagtgctc
acgcagatcgtcgaattggcacgcaagcacgagctgctgctgctcgccgacgagatctac
gacaagatcctctacggcgacgccaagcacatcaacctggcctcgctggcgccggacatg
ttgtgcctgacgttcaacgggctgtccaaggcctaccgcgtggccgggtatcgggccggc
tggctggcgatcaccgggcccaaggaccacgccggcagcttcatcgaggggatcaacttg
ctggcaaacatgcggctgtgccccaatgtcccggcgcagcacgcgatccaggtcgccctc
ggcggctaccagagcatcgacgacctcgtcctgcccggcggccggctgctcgagcagcgc
gacgtcgcctggaccaagctcaacgagattccgggggtgtcctgcgtcaagccggacggc
gctctctacgccttcccgcgtctggaccccgaggtctacgacatcgacgacgacgagcag
ctcgtcctcgatttgctgctgcaggagaagattctggtcacccagggcaccggcttcaat
tggcccgcaccggatcacctgcgcatcgtgaccctgccgtgggcccgcgatctggcggcg
gccatcgagcggctgggcaacttcctcgtcgcctatcgccagtaa

DBGET integrated database retrieval system