KEGG   Maylandia zebra (zebra mbuna): 101464130Help
Entry
101464130         CDS       T02814                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:mze00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mze00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 550 aa AA seqDB search
MLVGPQSWRACEKEAMKSSMRHWRRLMLVGILAWALFFLALLSYFLDARVDEPLTSAGAL
LSQHPDTRRLTSIQASHQQHAVVKLTLPLTTTYPRDKPELEPLVKSGTPETSLEMSQNPN
NLPYAVYGSQEVSRQDYLDPQSLAAWSSFGTENVGSHSDPVVQSRERQSQTADYQNHFSN
TQYQGGREEGDEKENEDLGNRRKNRVHSMAGDDFSDLEEFYFSKSISLIKRLWKGRVSAG
MLSLRLQRAMKEYVNSNKHHVSYKGNRKPAQSAKELLCELKNQARLRTVDGLEQPFSSLG
WARLVPSLPLEQLYKKENRRSFKTCAVVTSAGAILRSRLGKEIDAHDAVLRFNAAPTEGY
ERDVGNKTTIRIINSQILANPRHRFNTSSIYKNITLVAWDPAPYAVNLHKWYTSPDYNLF
GPYMEHRKLHPDQPFYILHPSYVWQLWDVIQGNTEEDIQPNPPSSGFIGILLMMALCEQV
HVYEYIPSMRQTDLCHYHEAYYDAACTLGAYHPLLYEKSLIQRINMGPVSDLERKGRVTL
PGFSTVNCDI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgggcccacagagctggcgtgcatgtgagaaagaggcaatgaagtccagtatg
aggcactggcggaggctgatgctggtgggaatactggcctgggctctcttctttctcgcc
ctcctgtcatatttcctggatgctcgtgtggatgagccccttacttctgctggtgcttta
ctctcccagcacccagacacacgccgtctgacctccatacaggcctcccatcaacagcat
gccgtggtaaagctgactttgccattaactacaacgtatcccagagataaaccggagctg
gagcctcttgtcaagtccgggaccccagagaccagcctggagatgagccagaacccaaac
aatcttccttacgctgtttatggcagccaggaagtaagtcgccaggactatcttgaccca
cagagcctggcagcctggtcttcctttggtacagaaaatgtgggttctcactcagatcct
gtagtccagagtcgtgagcgacagtcacagactgcagactatcagaaccacttcagcaac
actcaataccaaggtggcagggaggaaggtgatgaaaaagaaaatgaagatctgggaaac
agaaggaagaacagagtacacagtatggccggcgatgacttctctgatctggaggaattc
tatttctccaaatccatctcgctaataaagcggctctggaagggtcgagtgtcggcaggc
atgctgagtcttcgactgcagcgtgccatgaaggaatacgtcaactccaacaaacaccat
gtttcctacaaggggaatcgcaagcccgctcagagtgccaaggagctgctttgtgaattg
aagaatcaggcccggctgaggacagtagacgggttggagcaacccttctcttcacttggc
tgggctcgtctggtgccatcccttcccctggagcagctgtacaaaaaggagaacaggaga
agcttcaagacctgtgctgtggtcacctctgctggggccatccttcgctcacgattaggc
aaagagattgacgctcatgatgcagttttacgtttcaatgctgcacctacagaaggctac
gagagagacgtgggaaacaaaaccactatccgcatcatcaactcgcagattttggcaaat
cctaggcatcggttcaatacgagctctatctacaagaatataactctggtggcctgggac
cccgcaccttatgctgtcaacttacacaagtggtacactagtccggactacaacctgttc
ggtccatacatggagcaccgcaagctgcatcctgaccagcccttctacatccttcaccct
agctatgtgtggcagctctgggacgtgattcagggcaacacagaggaggacatccaaccc
aaccccccatcatctggcttcataggtatcctcctgatgatggcgctgtgcgagcaggtg
cacgtgtacgagtacattccctccatgaggcagacggacctgtgccactaccacgaggcc
tactatgacgctgcgtgcacactgggtgcctaccatcctctcctctatgagaaaagcctg
atccagcgaatcaacatgggccccgtgagtgacctcgagaggaaaggacgcgtcactctt
ccaggcttcagcaccgtgaactgtgacatctga

DBGET integrated database retrieval system