KEGG   Maylandia zebra (zebra mbuna): 101464333Help
Entry
101464333         CDS       T02814                                 

Definition
creatine kinase, testis isozyme-like
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101464333
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101464333
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101464333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 383 aa AA seqDB search
MEKISDKMVKLTLKRLSAEDEYPDLSQHNNYMAKVLTQDMYKKLRERATPSGFTIDGVIQ
TGVDNPGHPFIMTVGCVAGDEETYEVFKDLLDPVIEDRHGGYKPTDKHKTDLNSGNLKGG
DDLDPNYVLSSRVRTGRSIRGFSLPPHCSRGERRAVEKLSIEALASLSGDLKGKYYALKN
MTDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVI
SMQKGGNMKEVFTRFCTGLTKIESLFKERSHEFMWNEHLGYVLTCPSNLGTGLRAGVHVK
LPNLSKNTKFEEVLKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVK
LLVDMEKRLEKGQSIDDLMPAQK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatctctgacaaaatggtcaagctgaccctgaagaggctgtcagctgaggat
gagtacccagatctcagtcagcacaacaactacatggccaaggttttaacccaggacatg
tacaagaaactgagagagagggctacacccagcggcttcaccatagatggtgtcattcag
acaggggttgacaatcctggccaccccttcattatgactgtgggctgtgttgctggggat
gaggagacatacgaagtcttcaaagacctgttggaccctgtgatcgaggaccgacatgga
ggatacaaacccacagacaagcacaagactgacctcaactcaggcaacctgaagggtggt
gatgatctcgatcccaactacgtgctcagctccagggtccgaacaggccgcagcatccgc
ggcttcagtctgccaccacactgcagcagaggagagagacgcgctgtggaaaagctttcc
attgaagctctggcctctctgtctggagatctgaaggggaaatattatgccctgaagaac
atgactgacgcagagcagcagcagctcattgatgaccacttcctgtttgacaagccagtg
tctcctctgctgctggcctcagggatggcccgcgactggcccgatgccagaggcatctgg
cacaatgataacaagaccttcctggtgtgggtgaatgaagaggaccacttgcgtgtgatc
tcgatgcagaaaggaggcaacatgaaggaagtgtttacccgcttctgtaccgggctcaca
aagattgagagcctgttcaaggagaggagccatgaattcatgtggaatgagcacctgggt
tacgtcctcacctgcccgtctaacctgggcactggcctgcgtgcaggtgtacatgtgaag
ctgccaaacttgagcaaaaataccaagtttgaggaagttctcaagaagctgaggctccag
aaacgtggaactggtggagtggacactgctgctgtgggtggtgtctttgacatttccaat
gcggacaggctgggcttctctgaggtggagctggtgcagatggtggttgacggagtcaaa
ctgctggtggacatggaaaagaggctagagaaaggacagtccatcgatgacctgatgccc
gcccagaagtaa

DBGET integrated database retrieval system