KEGG   Maylandia zebra (zebra mbuna): 101464465Help
Entry
101464465         CDS       T02814                                 

Definition
histone acetyltransferase KAT6A-like
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101464465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2253 aa AA seqDB search
MVKLANPLYTQWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLALPKPKGVGSSSGSGGGSSGGGGGGAGGGSSSGGSSSHSH
SGKKPGLDWNKLIKRALEGLHEPGGSTLKNIERFLKCQADVAAYLSGSGSMGPGLFHQQL
RVALKRAVAHGRVAKQGPLFQLLSRSSNQDDGTGTVSLESLPPVRLLPHEKDKPVAEPIP
ICSFCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSS
CQDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRKKGKKLLHEKAAQI
KRRYNAPLGRPKNRPGRPFKKLGGRGRRKRSASANSSSSSSCEGYPGDDRLLFSMREDGD
LSHSSLRFNNKTKGLIDALTKFFTPSPEGRKARQEVVDYSQQCRIRKKASRKGEGDDRDN
QEGSDWRDEDDKLPGHENLTEKDIELFRHIQELALQKVGVTGPPDPQMRCPSVIEFGKYE
IQTWYSSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCNWFHPPANEIYRKDDISV
FEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYFSKEKHC
QQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYWRSV
VLECLHELRDRQITIRQLSKLTGICPQDITTTLHSLNMLEQRGDRLILMRREKLVANHMA
RLKARPRQLEVDPECLRWTPVIVTNTVVSDADGDDDDDDEEEEEDEEPKEGTRKEIKPSH
KVPQMSWHVRQGKKDEEEEEERKTFLGFPIGQSSPIPPPVRCPPPVPEPPRPPPPTNGER
RPRGRPPKNWPWGKVKDSARVGRPPKIRPVEDEDDEDEDRSEGVKTTGTVNSPPSLFSLD
RQADTTAFHTLDMSRHPSITPTRRGRPPRKKRGPKPRLIEGPGEGHPQLPVIPRLSESSP
VRKSRFSDSSEEEEDDDDEDDDERGCSPPMLTKSGLKCKKPMRKRRFRPRSHPHSSVVTE
TISETTEVLDEPFVDSDSERPMPRLEEETPLGHPLRRYPQPQSALRLSDPAPKRGRLSNL
TDSEEDELTTMPKSVAALTATPSETLGANPEVPVKKKKGWPKGKSRKPQHWKKRGKPPGT
GPNQRAAADGQAQSGNPQQPKIKMKPGRKPRSWYLQRAQEEADRQEQERQRLLEQQQMDK
VPQLLQTDDRNSKQVCRTNTDRDVKQKDSDEEDDYLPKPVEQKMPRKRGRPPKNRQPPQP
TPKPPPTSDPEEEDEDDEEDIERAWEEDKPSRPPSRPLLSPSSSSSTSGPRAPQSRPQDT
DMGDREEDDDDEEREEEECGSMGSGGGSVNRRAAVTPGSGSRRSDDHDADDEGDGHLEDK
SSSSKKRKSPDPEDEDDDEDEEEESASHANSPPVKEEPPGVEPFLGMENSVAQEYVSKQE
EEEEEEEAEERVQETKCRPPSADPQQEERRRREQEESAAAAAAVETVTAMSVPSEPMELQ
PLHPDDKDVTLLMEPQHPHSHPHQHPDFKEELGHHHSHHSHHHSNELDLETMQAVQSLTQ
GEAQDEETEPQPHHGAYQDCEETLAACRTLQSYSHTGEPEEETLALVEECGASQHSSPLP
NPPVPPLPSQSVRSVNSPGLQSGIVDTTPAGQRGGTPGPTGAGSSGGGAGGGYTQITPEH
PSSLSAPSQQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGG
GGNGTGNGGNGGGMSAAVVAGASTASASSASSSSSSATPSSSSQSNSCSFVPAPSLTSST
GNAASQLAMGSCSLIQQTGPGPNSGPGASNVGSAVPQPPPPPPPSNTPSCGIKSPQSCGV
IERPPSTNQQQQSTKKVPQQQQQAPNPQPPPSAPPPPPQQALSQCSMGNGFASTPMIMEI
PESGGGGGGRTLYERMGQDFGTGGYPQPSATFSLAKLQQLTNTIMEPHGMPYSHSAAVTS
YATSVSLSNPGLAPSPHTALPQGQPTMTPPPNLSSGSMNLGSLQLQCNMPTTNIGLGPPP
HTQRLQGQMTTVKGHISIRSKATQQLAPAPHQQQLYSRSSGTVAMQGTPRTLAVQRGMMP
NLMPTAPYNSMNMTTLNPMSASYRMAQPMMNSGYHSNPAYMNQPAQYPMQMQVGMMGGQG
YPQQPMQPNHHGNMMYTGPSHHSYPKQPHYMSR
NT seq 6762 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactggcaaacccattgtacacccaatggattctagaggccatcaagaaggta
aagaagcagaagcagcgaccatcagaggagcgcatttgcaatgcggtctctatgtcccat
ggcctggaccgcaaaacagttctggagcagttagagcttagtgtcaaggatggtaccata
ctcaaggttaccaacaaaggtctcaactcctacaaggacccagataaccctgggcgcttg
gccctgcccaagcccaaaggtgttggcagctccagtggcagcggaggcggcagctccggt
ggaggaggtggaggagcaggtggtggcagcagcagtggagggagcagctctcactcgcat
tcggggaagaaaccgggtctcgactggaacaaattaattaagcgggcactggaggggctc
cacgagccgggtggctccaccttaaagaacatcgaacgcttcctcaagtgtcaggctgat
gtggcggcgtacctgtcgggtagcggctccatgggcccgggcctcttccaccagcagctg
agggtagccctcaagagagccgtggcccacgggcgcgtggccaaacagggtccactgttc
cagctcctcagccgtagcagcaaccaggatgatgggactggcacggtgtctctggaatcg
ctgcccccggtccggttgctgccacacgagaaagacaagccggtggcggagcccatcccc
atctgcagcttctgtttggggaccaaggagcagaatcgcgacaagaagccagaggagctc
atctcctgcgccgactgtggcaacagcggccacccgtcctgtctcaaattctccccggag
ctcacagtgcgagtcaaggctctgtggtggcagtgcatcgaatgcaagacttgcagcagc
tgtcaggatcaaggaaagaatgcggacaacatgttgttctgcgactcctgtgaccggggc
ttccacatggagtgctgcgatcctcctctcacgcggatgccaaaaggcatgtggatttgt
caaatctgccaaccaaggaaaaagggaaagaagcttttacacgaaaaggctgcgcaaatc
aaacggcgctacaacgcaccgctgggacggcccaagaacaggccggggcggccctttaag
aagctgggagggcgcggtcggcggaagcgctcggcctcagcaaactcttcctccagctcc
tcctgcgaaggttaccccggagacgacaggctgcttttttccatgcgggaggacggcgac
ctgtcacacagcagcctgcgcttcaacaacaagaccaagggcctcatcgatgccctcaca
aagttcttcacgccatctcccgagggccgcaaggcacggcaggaagtggtggactactca
cagcagtgccgcatccgaaagaaagccagtcgcaaaggcgaaggagatgacagagacaat
caggaaggcagcgactggcgtgacgaagatgacaaactgcccggccacgagaacctgacg
gaaaaagacatcgagctgttcagacacatccaggagctggcgctacagaaagttggcgtg
acgggtccgccagaccctcaaatgcgttgcccgtcagtcattgaatttggcaagtatgaa
atccagacgtggtattcgtctccatacccgcaggagtacagcagactacctaaactctac
ctgtgtgagttctgcctgcgctacatgaaaagtcgcagcatcctctaccagcacatgaag
aagtgcaactggttccaccctcctgccaatgagatctacaggaaggacgacatctctgta
ttcgaggttgatgggaatgttagcacaatctactgtcagaacctgtgtctactcgctaaa
ctgttcctggaccacaagaccctctactacgatgtggagcccttccttttctacgtcctc
acccagaatgacagtaaaggctgtcaccttgttggctacttctctaaggagaagcactgt
caacagaaatacaacgtatcatgcatcatgattcttccacagtaccagcgcaagggctat
gggcgttttctcatcgacttcagctacttgctgtcaaagcgagagggacagccaggatct
ccggagaagcctctgtcggacttaggtcggctgtcttacatggcctactggcgtagcgtg
gtgctggagtgtctccacgagctccgcgaccggcagatcaccatacgacagctcagcaaa
ctgacggggatctgcccccaggacatcaccaccaccctgcatagcctcaacatgctggag
cagcggggagaccgactcatcctgatgcgaagggagaagctggtggccaaccacatggct
cgtctaaaggcccggccacgacagctggaggtcgaccccgagtgtctccgctggactcct
gtcatagtaaccaacaccgtggtctctgatgctgatggagatgacgacgacgatgatgag
gaggaggaggaggatgaggaaccaaaggaagggactcgcaaggagattaagccgagtcac
aaggtcccacagatgtcctggcatgtacggcaagggaagaaggatgaagaagaggaggag
gaaaggaagacctttctaggatttccgattggccaaagctctccaattccccctccagtc
cgatgcccaccgcctgtaccagaaccaccacgaccccctccgccaacaaacggcgaacgc
aggccacgagggcgcccgcccaaaaactggccttggggtaaggtgaaggacagcgcgcgg
gtgggacggccacccaaaatccgtccagtagaggatgaagatgatgaggacgaggacagg
tcagagggggtaaaaaccacaggcactgtcaacagcccgccctcccttttctccttggac
agacaagcagacacgacagcctttcacacactcgacatgagcaggcacccttccataacc
cccacgagacgaggccggccaccgaggaaaaagagaggcccgaagcccagactgatagaa
ggtcccggagagggtcacccacagcttcctgtgattcccaggctgagcgagtcttctcca
gtcaggaagagccgcttcagtgacagcagcgaagaagaggaggatgatgatgatgaagat
gacgacgagaggggatgctcccctcctatgctcaccaaatcagggctcaaatgcaagaag
cccatgaggaagcgccgctttcgcccgcgcagccaccctcacagcagcgtggtgactgag
accatttcggagaccacggaggtgttggatgagccttttgtagactctgactcagagagg
cctatgcccaggctggaggaggagactccactgggtcacccgctgcgccgctacccccaa
ccgcagtctgctctgaggttgtctgaccctgcgccaaagaggggccgactctccaacctc
acagattcggaggaagatgagctaacaactatgccgaagtctgtagctgctttgacagca
accccatcagagacccttggagccaaccctgaagtcccagtcaaaaagaagaaaggctgg
cccaaaggaaagagccgcaaaccacagcactggaagaaaagaggcaagccacctggcaca
ggacccaaccagagagcagctgcagacggccaggcccaaagtgggaatcctcagcaaccc
aaaatcaagatgaagcctggtcgcaagccacggagctggtacttgcagcgggcccaggag
gaggcggacaggcaggagcaggaaagacaaaggttgctagagcagcagcagatggacaaa
gttcctcagctgctgcagacggatgaccggaacagcaagcaagtctgcagaactaacacg
gacagagacgtcaaacaaaaagactctgacgaagaagatgactatctccctaagcccgtt
gaacaaaagatgcccagaaagcgggggagaccgcccaagaaccgccagccaccacagcct
acccccaaaccacctcccacctctgacccggaagaagaggatgaagatgatgaggaggac
atcgagcgagcctgggaagaagacaaacctagccggccaccatcccgtccactgctttcc
ccttcttcctcttcttccacctcagggccccgggccccgcagtcccggcctcaggacaca
gatatgggtgacagagaggaagacgatgatgatgaggaaagggaggaagaggagtgtggc
agcatgggcagtggtggtggtagcgtgaacaggcgagcggcggtcacgccgggttcagga
agccggcgaagtgacgaccacgatgcagacgatgagggtgacggacacttagaagacaag
agcagcagcagtaaaaagagaaaaagtccggaccctgaagacgaagacgacgatgaagac
gaggaggaggagtctgcctcacacgcaaactcgcctccagtcaaagaagaacccccaggt
gtagagccttttttaggcatggagaacagcgtggcccaggagtacgtcagcaaacaggag
gaggaagaggaggaggaggaggctgaggaaagggtgcaggagaccaagtgccggcccccc
tctgcagaccctcagcaggaggagaggaggcgcagagagcaggaggagtctgctgcagcg
gcggcggcggtggaaacggtcacggccatgtctgttccttctgagccaatggagctgcag
cccctgcacccggatgataaagacgtcacactcttgatggaaccccagcatccgcactcc
caccctcaccagcaccctgacttcaaggaggagcttggccaccatcactcgcaccactca
catcaccactccaatgagctggacctggagactatgcaggctgttcagtccctgacgcag
ggggaagcccaggacgaggaaactgagccccagccacaccacggcgcttaccaggactgt
gaagagaccctagccgcctgccggaccctgcagagctacagtcacacgggcgagcctgaa
gaggagaccctagccttagtagaggaatgtggagcctcccagcacagcagccccctccct
aatccaccagtgcccccgctgcccagtcagtctgtgcgctctgtgaacagcccggggctg
caatcgggcattgtggatacgacaccagcagggcaaaggggtggaactcctggccccacc
ggagcagggagcagtggcggtggcgctggaggtggctacacacagatcactccagagcat
cccagttcgctttctgccccctctcaacagaacatggagacatcgccgatgatggatgtg
ccgtctgtgtcggaccactcgcagcaggtggtggacagtggcttcagtgacctgggcagc
attgaaagcactacagagaattatgacaaccccagcagctacgactccaccatgggtgga
gggggcaatggaacaggaaacgggggcaatggaggaggaatgtctgctgccgtggtcgct
ggggcttcaacggcttcagcgtcctcggcgtcctcttcttccagctctgccaccccttct
tcctcctctcagtccaacagctgctccttcgtgccagcccccagcctcacatcttccaca
ggaaatgccgcatcccagctagcgatgggcagctgtagcctcattcagcaaacaggacca
gggcccaacagtggaccaggtgccagcaacgtgggcagtgctgtgccccagcccccgcct
cccccaccgccatccaacacccccagctgtggcattaagtctcctcagagctgtggtgtg
attgagaggcctcccagcaccaaccagcagcagcaatcaacaaaaaaggttcctcaacag
cagcaacaagcgcccaaccctcagcctccaccctcggccccgccaccgccaccacagcag
gccttgtcccagtgcagcatgggcaatggctttgcctccacgcccatgatcatggagatt
ccagagagtggaggtggaggagggggccgcaccctgtatgagcgcatgggtcaggacttt
ggtacagggggctacccccagccctcggcaacattcagcctggccaaactccagcagctc
accaacaccatcatggagccccacggcatgccctactctcactccgccgctgttacctcc
tatgccactagtgtttctctctccaatcctgggctggccccttcaccccacactgccctt
ccacaggggcagcccactatgaccccacctcctaaccttagctctggctccatgaacctg
ggctctctgcagctgcaatgcaacatgcccacgaccaacattggcctaggacctccaccg
cacacacagcggctgcagggccagatgactaccgtcaaaggccacatttccattcggtcc
aaagccactcagcagctggccccggccccgcaccagcagcagctctatagccgcagctcg
gggactgtggccatgcagggtacgccgcgcaccttggccgtgcagcgcggcatgatgcca
aacctcatgcccacggcaccgtataattctatgaacatgacgactctgaaccccatgtca
gccagctaccgaatggctcagcctatgatgaacagtggctatcacagcaaccccgcatac
atgaatcagccagctcagtaccccatgcagatgcaggtgggcatgatgggagggcagggc
tacccacagcagcctatgcagcccaatcaccatgggaacatgatgtacactggcccctcc
catcacagctatccaaaacagccacattacatgagcagatga

DBGET integrated database retrieval system