KEGG   Maylandia zebra (zebra mbuna): 101464465Help
Entry
101464465         CDS       T02814                                 

Gene name
kat6a
Definition
(RefSeq) histone acetyltransferase KAT6A
  KO
K11305  histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101464465 (kat6a)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101464465 (kat6a)
   HAT complexes
    MOZ/MORF complex
     101464465 (kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS PHD Linker_histone Acetyltransf_7 PHD_2 DUF212 SgrR_N
Motif
Other DBs
NCBI-GeneID: 101464465
NCBI-ProteinID: XP_004567330
Position
LG12
AA seq 2250 aa AA seqDB search
MVKLANPLYTQWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLALPKPKGVGSSSGSGGGSSGGGAGGGSSSGGSSSHSHSGK
KPGLDWNKLIKRALEGLHEPGGSTLKNIERFLKCQADVAAYLSGSGSMGPGLFHQQLRVA
LKRAVAHGRVAKQGPLFQLLSRSSNQDDGTGTVSLESLPPVRLLPHEKDKPVAEPIPICS
FCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSSCQD
QGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRKKGKKLLHEKAAQIKRR
YNAPLGRPKNRPGRPFKKLGGRGRRKRSASANSSSSSSCEGYPGDDRLLFSMREDGDLSH
SSLRFNNKTKGLIDALTKFFTPSPEGRKARQEVVDYSQQCRIRKKASRKGEGDDRDNQEG
SDWRDEDDKLPGHENLTEKDIELFRHIQELALQKVGVTGPPDPQMRCPSVIEFGKYEIQT
WYSSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCNWFHPPANEIYRKDDISVFEV
DGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYFSKEKHCQQK
YNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYWRSVVLE
CLHELRDRQITIRQLSKLTGICPQDITTTLHSLNMLEQRGDRLILMRREKLVANHMARLK
ARPRQLEVDPECLRWTPVIVTNTVVSDADGDDDDDDEEEEEDEEPKEGTRKEIKPSHKVP
QMSWHVRQGKKDEEEEEERKTFLGFPIGQSSPIPPPVRCPPPVPEPPRPPPPTNGERRPR
GRPPKNWPWGKVKDSARVGRPPKIRPVEDEDDEDEDRSEGVKTTGTVNSPPSLFSLDRQA
DTTAFHTLDMSRHPSITPTRRGRPPRKKRGPKPRLIEGPGEGHPQLPVIPRLSESSPVRK
SRFSDSSEEEEDDDDEDDDERGCSPPMLTKSGLKCKKPMRKRRFRPRSHPHSSVVTETIS
ETTEVLDEPFVDSDSERPMPRLEEETPLVHPLRRYPQPQSALRLSDPAPKRGRLSNLTDS
EEDELTTMPKSVAALTATPSETLGANPEVPVKKKKGWPKGKSRKPQHWKKRGKPPGTGPN
QRAAADGQAQSGNPQQPKIKMKPGRKPRSWYLQRAQEEADRQEQERQRLLEQQQMDKVPQ
LLQTDDRNSKQVCRTNTDRDVKQKDSDEEDDYLPKPVEQKMPRKRGRPPKNRQPPQPTPK
PPPTSDPEEEDEDDEEDIERAWEEDKPSRPPSRPLLSPSSSSSTSGPRAPQSRPQDTDMG
DREEDDDDEEREEEECGSMGSGGGSVNRRAAVTPGSGSRRSDDHDADDEGDGHLEDKSSS
SKKRKSPDPEDEDDDEDEEEESASHANSPPVKEEPPGVEPFLGMENSVAQEYVSKQEEEE
EEEEAEERVQETKCRPPSADPQQEERRRREQEESAAAAAAVETVTAMSVPSEPMELQPLH
PDDKDVTLLMEPQHPHSHPHQHPDFKEELGHHHSHHSHHHSNELDLETMQAVQSLTQGEA
QDEETEPQPHHGAYQDCEETLAACRTLQSYSHTGEPEEETLALVEECGASQHSSPLPNPP
VPPLPSQSVRSVNSPGLQSGIVDTTPAGQRGGTPGPTGAGSSGGGAGGGYTQITPEHPSS
LSAPSQQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGN
GTGNGGNGGGMSAAVVAGASTASASSASSSSSSATPSSSSQSNSCSFVPAPSLTSSTGNA
ASQLAMGSCSLIQQTGPGPNSGPGASNVGSAVPQPPPPPPPSNTPSCGIKSPQSCGVIER
PPSTNQQQQSTKKVPQQQQQAPNPQPPPSAPPPPPQQALSQCSMGNGFASTPMIMEIPES
GGGGGGRTLYERMGQDFGTGGYPQPSATFSLAKLQQLTNTIMEPHGMPYSHSAAVTSYAT
SVSLSNPGLAPSPHTALPQGQPTMTPPPNLSSGSMNLGSLQLQCNMPTTNIGLGPPPHTQ
RLQGQMTTVKGHISIRSKATQQLAPAPHQQQLYSRSSGTVAMQGTPRTLAVQRGMMPNLM
PTAPYNSMNMTTLNPMSASYRMAQPMMNSGYHSNPAYMNQPAQYPMQMQVGMMGGQGYPQ
QPMQPNHHGNMMYTGPSHHSYPKQPHYMSR
NT seq 6753 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactggcaaacccattgtacacccaatggattctagaggccatcaagaaggta
aagaagcagaagcagcgaccatcagaggagcgcatttgcaatgcggtctctatgtcccat
ggcctggaccgcaaaacagttctggagcagttagagcttagtgtcaaggatggtaccata
ctcaaggttaccaacaaaggtctcaactcctacaaggacccagataaccctgggcgcttg
gccctgcccaagcccaaaggtgttggcagctccagtggcagcggaggcggcagctccggt
ggaggagcaggtggtggcagcagcagtggagggagcagctctcactcgcattcggggaag
aaaccgggtctcgactggaacaaattaattaagcgggcactggaggggctccacgagccg
ggtggctccaccttaaagaacatcgaacgcttcctcaagtgtcaggctgatgtggcggcg
tacctgtcgggtagcggctccatgggcccgggcctcttccaccagcagctgagggtagcc
ctcaagagagccgtggcccacgggcgcgtggccaaacagggtccactgttccagctcctc
agccgtagcagcaaccaggatgatgggactggcacggtgtctctggaatcgctgcccccg
gtccggttgctgccacacgagaaagacaagccggtggcggagcccatccccatctgcagc
ttctgtttggggaccaaggagcagaatcgcgacaagaagccagaggagctcatctcctgc
gccgactgtggcaacagcggccacccgtcctgtctcaaattctccccggagctcacagtg
cgagtcaaggctctgtggtggcagtgcatcgaatgcaagacttgcagcagctgtcaggat
caaggaaagaatgcggacaacatgttgttctgcgactcctgtgaccggggcttccacatg
gagtgctgcgatcctcctctcacgcggatgccaaaaggcatgtggatttgtcaaatctgc
caaccaaggaaaaagggaaagaagcttttacacgaaaaggctgcgcaaatcaaacggcgc
tacaacgcaccgctgggacggcctaagaacaggccggggcggccctttaagaagctggga
gggcgcggtcggcggaagcgctcggcctcagcaaactcttcctccagctcctcctgcgaa
ggttaccccggagacgacaggctgcttttttccatgcgggaggacggcgacctgtcacac
agcagcctgcgcttcaacaacaagaccaagggcctcatcgatgccctcacaaagttcttc
acgccatctcccgagggccgcaaggcacggcaggaagtggtggactactcacagcagtgc
cgcatccgaaagaaagccagtcgcaaaggcgaaggagatgacagagacaatcaggaaggc
agcgactggcgtgacgaagatgacaaactgcccggccacgagaacctgacggaaaaagac
atcgagctgttcagacacatccaggagctggcgctacagaaagttggcgtgacgggtccg
ccagaccctcaaatgcgttgcccgtcagtcattgaatttggcaagtatgaaatccagacg
tggtattcgtctccatacccgcaggagtacagcagactacctaaactctacctgtgtgag
ttctgcctgcgctacatgaaaagtcgcagcatcctctaccagcacatgaagaagtgcaac
tggttccaccctcctgccaatgagatctacaggaaggacgacatctctgtattcgaggtt
gatgggaatgttagcacaatctactgtcagaacctgtgtctactcgctaaactgttcctg
gaccacaagaccctctactacgatgtggagcccttccttttctacgtcctcacccagaat
gacagtaaaggctgtcaccttgttggctacttctctaaggagaagcactgtcaacagaaa
tacaacgtatcatgcatcatgattcttccacagtaccagcgcaagggctatgggcgtttt
ctcatcgacttcagctacttgctgtcaaagcgagagggacagccaggatctccggagaag
cctctgtcggacttaggtcggctgtcttacatggcctactggcgtagcgtggtgctggag
tgtctccacgagctccgcgaccggcagatcaccatacgacagctcagcaaactgacgggg
atctgcccccaggacatcaccaccaccctgcatagcctcaacatgctggagcagcgggga
gaccgactcatcctgatgcgaagggagaagctggtggccaaccacatggctcgtctaaag
gcccggccacgacagctggaggtcgaccccgagtgtctccgctggactcctgtcatagta
accaacaccgtggtctctgatgctgatggagatgacgacgacgatgatgaggaggaggag
gaggatgaggaaccaaaggaagggactcgcaaggagattaagccgagtcacaaggtccca
cagatgtcctggcatgtacggcaagggaagaaggatgaagaagaggaggaggaaaggaag
acctttctaggatttccgattggccaaagctctccaattccccctccagtccgatgccca
ccgcctgtaccagaaccaccacgaccccctccgccaacaaacggcgaacgcaggccacga
gggcgcccgcccaaaaactggccttggggtaaggtgaaggacagcgcgcgggtgggacgg
ccacccaaaatccgtccagtagaggatgaagatgatgaggacgaggacaggtcagagggg
gtaaaaaccacaggcactgtcaacagcccgccctcccttttctccttggacagacaagca
gacacgacagcctttcacacactcgacatgagcaggcacccttccataacccccacgaga
cgaggccggccaccgaggaaaaagagaggcccgaagcccagactgatagaaggtcccgga
gagggtcacccacagcttcctgtgattcccaggctgagcgagtcttctccagtcaggaag
agccgcttcagtgacagcagcgaagaagaggaggatgatgatgatgaagatgacgacgag
aggggatgctcccctcctatgctcaccaaatcagggctcaaatgcaagaagcccatgagg
aagcgccgctttcgcccgcgcagccaccctcacagcagcgtggtgactgagaccatttcg
gagaccacggaggtgttggatgagccttttgtagactctgactcagagaggcctatgccc
aggctggaggaggagactccactggttcacccgctgcgccgctacccccaaccgcagtct
gctctgaggttgtctgaccctgcgccaaagaggggccgactctccaacctcacagattcg
gaggaagatgagctaacaactatgccgaagtctgtagctgctttgacagcaaccccatca
gagacccttggagccaaccctgaagtcccagtcaaaaagaagaaaggctggcccaaagga
aagagccgcaaaccacagcactggaagaaaagaggcaagccacctggcacaggacccaac
cagagagcagctgcagacggccaggcccaaagtgggaatcctcagcaacccaaaatcaag
atgaagcctggtcgcaagccacggagctggtacttgcagcgggcccaggaggaggcggac
aggcaggagcaggaaagacaaaggttgctagagcagcagcagatggacaaagttcctcag
ctgctgcagacggatgaccggaacagcaagcaagtctgcagaactaacacggacagagac
gtcaaacaaaaagactctgacgaagaagatgactatctccctaagcccgttgaacaaaag
atgcccagaaagcgggggagaccgcccaagaaccgccagccaccacagcctacccccaaa
ccacctcccacctctgacccggaagaagaggatgaagatgatgaggaggacatcgagcga
gcctgggaagaagacaaacctagccggccaccatcccgtccactgctttccccttcttcc
tcttcttccacctcagggccccgggccccgcagtcccggcctcaggacacagatatgggt
gacagagaggaagacgatgatgatgaggaaagggaggaagaggagtgtggcagcatgggc
agtggtggtggtagcgtgaacaggcgagcggcggtcacgccgggttcaggaagccggcga
agtgacgaccacgatgcagacgatgagggtgacggacacttagaagacaagagcagcagc
agtaaaaagagaaaaagtccggaccctgaagacgaagacgacgatgaagacgaggaggag
gagtctgcctcacacgcaaactcgcctccagtcaaagaagaacccccaggtgtagagcct
tttttaggcatggagaacagcgtggcccaggagtacgtcagcaaacaggaggaggaagag
gaggaggaggaggctgaggaaagggtgcaggagaccaagtgccggcccccctctgcagac
cctcagcaggaggagaggaggcgcagagagcaggaggagtctgctgcagcggcggcggcg
gtggaaacggtcacggccatgtctgttccttctgagccaatggagctgcagcccctgcac
ccggatgataaagacgtcacactcttgatggaaccccagcatccgcactcccaccctcac
cagcaccctgacttcaaggaggagcttggccaccatcactcgcaccactcacatcaccac
tccaatgagctggacctggagactatgcaggctgttcagtccctgacgcagggggaagcc
caggacgaggaaactgagccccagccacaccacggcgcttaccaggactgtgaagagacc
ctagccgcctgccggaccctgcagagctacagtcacacgggcgagcctgaagaggagacc
ctagccttagtagaggaatgtggagcctcccagcacagcagccccctccctaatccacca
gtgcccccgctgcccagtcagtctgtgcgctctgtgaacagcccggggctgcaatcgggc
attgtggatacgacaccagcagggcaaaggggtggaactcctggccccaccggagcaggg
agcagtggcggtggcgctggaggtggctacacacagatcactccagagcatcccagttcg
ctttctgccccctctcaacagaacatggagacatcgccgatgatggatgtgccgtctgtg
tcggaccactcgcagcaggtggtggacagtggcttcagtgacctgggcagcattgaaagc
actacagagaattatgacaaccccagcagctacgactccaccatgggtggagggggcaat
ggaacaggaaacggaggcaatggaggaggaatgtctgctgccgtggtcgccggggcttca
acggcttcagcgtcctcggcgtcctcttcttccagctctgccaccccttcttcctcctct
cagtccaacagctgctccttcgtgccagcccccagcctcacatcttccacaggaaatgcc
gcatcccagctagcgatgggcagctgtagcctcattcagcaaacaggaccagggcccaac
agtggaccaggtgccagcaacgtgggcagtgctgtgccccagcccccgcctcccccaccg
ccatccaacacccccagctgtggcattaagtctcctcagagctgtggtgtgattgagagg
cctcccagcaccaaccagcagcagcaatcaacaaaaaaggttcctcaacagcagcaacaa
gcgcccaaccctcagcctccaccctcggccccgccaccgccaccacagcaggccttgtcc
cagtgcagcatgggcaatggctttgcctccacgcccatgatcatggagattccagagagt
ggaggtggaggagggggccgcaccctgtatgagcgcatgggtcaggactttggtacaggg
ggctacccccagccctcggcaacattcagcctggccaaactccagcagctcaccaacacc
atcatggagccccacggcatgccctactctcactccgccgctgttacctcctatgccact
agtgtttctctctccaatcctgggctggccccttcaccccacactgcccttccacagggg
cagcccactatgaccccacctcctaaccttagctctggctccatgaacctgggctctctg
cagctgcaatgcaacatgcccacgaccaacattggcctaggacctccaccgcacacacag
cggctgcagggccagatgactaccgtcaaaggccacatttccattcggtccaaagccact
cagcagctggccccggccccgcaccagcagcagctctatagccgcagctcggggactgtg
gccatgcagggtacgccgcgcaccttggccgtgcagcgcggcatgatgccaaacctcatg
cccacggcaccgtataattctatgaacatgacgactctgaaccccatgtcagccagctac
cgaatggctcagcctatgatgaacagtggctatcacagcaaccccgcatacatgaatcag
ccagctcagtaccccatgcagatgcaggtgggcatgatgggagggcagggctacccacag
cagcctatgcagcccaatcaccatgggaacatgatgtacactggcccctcccatcacagc
tatccaaaacagccacattacatgagcagatga

DBGET integrated database retrieval system