KEGG   Maylandia zebra (zebra mbuna): 101464817Help
Entry
101464817         CDS       T02814                                 

Gene name
dbh
Definition
(RefSeq) dopamine beta-hydroxylase isoform X1
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00350  Tyrosine metabolism
mze01100  Metabolic pathways
Module
mze_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101464817 (dbh)
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101464817 (dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 101464817
NCBI-ProteinID: XP_004538354
Position
LG7
AA seq 614 aa AA seqDB search
MRIFSKNLRLQDITIMYFTALAALMVILVASYQAPNNAVEVSSLKPNPSRPLPPLPMPFR
VPLDPRGELQLAWNVSYTNQEIYMELRVAELRHGVVLGMSDRGELTNADLLVLWDSGTQS
YFGDAWSDSKGHVSLDSQQDYDLIEAKQKAEGYYLLFKRPFSTCDPRDYVIEEGTVHIIY
GFLDKPLASLDKLNLSEIRTGVQRVLMLRPDTPPPTLPPDVQMLDVVAPNVIIPNQETTY
WCYIHNLPENLAKNHIVMYESAITPGNEAIVHHIEVFECSPDVPAVPGYSGSCDDKMKPK
KLNFCRHVLAAWAMGAEAFYYPPDAGLAMGGPGSSRFLRLEVHYHNPLLISGRRDSSGIR
LYYTPSLRRYDAGIMELGLVYTPVMAIPPKQHTFYLSGYCTSKCTQTALPSGGIYVFASQ
LHTHLAGRGVRTILVRGGKELEVVQEDQHFSTHYQTIRVLRKMVNILPGDVLITKCTYNT
EDRSKPTVGGFGIMEEMCVNYIHYYPRTQLELCKSHVDQGYLQKYFNFINRFHGNDQCVC
GEVSVTEQFSQLEWDEFTGEVLDSLYNTAPISMHCNQSTARLFPGDWDKQPIPAVTSVLE
KPQYTCKRGTLRTN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcttcagcaaaaaccttcgccttcaggacataaccatcatgtattttactgcc
ctggctgctctaatggtcatcttggtggcttcttaccaggcgcccaacaatgctgttgaa
gtgtccagccttaaaccgaacccctctcgccctctcccacctctccccatgcctttccgg
gtgccccttgatccacgtggggagctccagctggcttggaacgtcagctacaccaaccag
gagatttatatggagctgagggttgcagagctcagacacggggtggtcctggggatgtcc
gatcggggagagctgaccaatgctgacctgttggtactgtgggactctggaacccagagc
tactttggagatgcttggagtgacagcaagggtcatgtatcactagacagccaacaagac
tacgacctgattgaagccaaacagaaagctgaaggatattacctgctcttcaaaagacca
ttcagtacctgcgatcccagagactacgtcatagaggaggggactgtgcacatcatctac
ggcttcttggataaaccacttgcctcactggataagctgaacctgtccgagatccgcacc
ggcgtacagagagtcctgatgttgcgtcccgacacgccgccacctaccctgcctccagac
gtacaaatgttagatgtagtggcaccaaatgtcatcataccaaatcaagagaccacctac
tggtgctacatccacaacctgccggaaaatttggccaagaaccacattgttatgtacgag
tcggcgataactccagggaacgaggccatcgtgcatcacatagaagtgtttgagtgttct
ccggatgtccctgcagttccagggtacagcggctcctgtgatgacaaaatgaagccgaaa
aagctcaacttttgccgacacgtgctagctgcatgggctatgggggctgaggctttctac
tatccccctgatgcaggcttggctatgggtggaccaggttcctcaagattcctccgtctg
gaggtccattaccacaaccctctccttatatccggccggcgtgactcatcagggatacga
ctgtattacaccccgagcctgaggcgctacgatgcagggatcatggagctgggcctcgtt
tacactcctgtaatggctatcccacctaaacaacacaccttttacctcagtggatactgc
acctccaagtgtacccaaacagctttgccttcaggtggaatctatgtatttgcttcccag
ctgcacacccacttggcggggcgtggggtgaggacgattttggtgaggggaggcaaagag
ctggaggtggtacaggaagaccagcatttcagtacgcactaccagacaatccgagttctt
aggaaaatggtgaacattttgcctggtgacgtacttataacaaagtgtacttataacaca
gaagataggagcaagcctacagtgggtggttttggcatcatggaggaaatgtgtgtcaac
tacattcactactacccccgtacccagctggagctctgcaagagccacgttgaccaagga
tacctgcagaaatattttaacttcattaacaggttccacggaaatgaccagtgtgtgtgt
ggtgaggttagtgtgacggagcagttttctcaactagagtgggatgaattcaccggagaa
gtgctggactcgctttataacacagcccccatctcgatgcactgcaatcagtcgactgca
cgcctctttcctggtgactgggacaaacagcccataccagcggtgacctccgtccttgaa
aaacctcagtacacctgtaagcgaggcacgcttcgcaccaactga

DBGET integrated database retrieval system