KEGG   Maylandia zebra (zebra mbuna): 101464817Help
Entry
101464817         CDS       T02814                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101464817
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101464817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 614 aa AA seqDB search
MRIFSKNLRLQDITIMYFTALAALMVILVASYQAPNNAVEVSSLKPNPSRPLPPLPMPFR
VPLDPRGELQLAWNVSYTNQEIYMELRVAELRHGVVLGMSDRGELTNADLLVLWDSGTQS
YFGDAWSDSKGHVSLDSQQDYDLIEAKQKAEGYYLLFKRPFSTCDPRDYVIEEGTVHIIY
GFLDKPLASLDKLNLSEIRTGVQRVLMLRPDTPPPTLPPDVQMLDVVAPNVIIPNQETTY
WCYIHNLPENLAKNHIVMYESAITPGNEAIVHHIEVFECSPDVPAVPGYSGSCDDKMKPK
KLNFCRHVLAAWAMGAEAFYYPPDAGLAMGGPGSSRFLRLEVHYHNPLLISGRRDSSGIR
LYYTPSLRRYDAGIMELGLVYTPVMAIPPKQHTFYLSGYCTSKCTQTALPSGGIYVFASQ
LHTHLAGRGVRTILVRGGKELEVVQEDQHFSTHYQTIRVLRKMVNILPGDVLITKCTYNT
EDRSKPTVGGFGIMEEMCVNYIHYYPRTQLELCKSHVDQGYLQKYFNFINRFHGNDQCVC
GEVSVTEQFSQLEWDEFTGEVLDSLYNTAPISMHCNQSTARLFPGDWDKQPIPAVTSVLE
KPQYTCKRGTLRTN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcttcagcaaaaaccttcgccttcaggacataaccatcatgtattttactgcc
ctggctgctctaatggtcatcttggtggcttcttaccaggcgcccaacaatgctgttgaa
gtgtccagccttaaaccgaacccctctcgccctctcccacctctccccatgcctttccgg
gtgccccttgatccacgtggggagctccagctggcttggaacgtcagctacaccaaccag
gagatttatatggagctgagggttgcagagctcagacacggggtggtcctggggatgtcc
gatcggggagagctgaccaatgctgacctgttggtactgtgggactctggaacccagagc
tactttggagatgcttggagtgacagcaagggtcatgtatcactagacagccaacaagac
tacgacctgattgaagccaaacagaaagctgaaggatattacctgctcttcaaaagacca
ttcagtacctgcgatcccagagactacgtcatagaggaggggactgtgcacatcatctac
ggcttcttggataaaccacttgcctcactggataagctgaacctgtccgagatccgcacc
ggcgtacagagagtcctgatgttgcgtcccgacacgccgccacctaccctgcctccagac
gtacaaatgttagatgtagtggcaccaaatgtcatcataccaaatcaagagaccacctac
tggtgctacatccacaacctgccggaaaatttggccaagaaccacattgttatgtacgag
tcggcgataactccagggaacgaggccatcgtgcatcacatagaagtgtttgagtgttct
ccggatgtccctgcagttccagggtacagcggctcctgtgatgacaaaatgaagccgaaa
aagctcaacttttgccgacacgtgctagctgcatgggctatgggggctgaggctttctac
tatccccctgatgcaggcttggctatgggtggaccaggttcctcaagattcctccgtctg
gaggtccattaccacaaccctctccttatatccggccggcgtgactcatcagggatacga
ctgtattacaccccgagcctgaggcgctacgatgcagggatcatggagctgggcctcgtt
tacactcctgtaatggctatcccacctaaacaacacaccttttacctcagtggatactgc
acctccaagtgtacccaaacagctttgccttcaggtggaatctatgtatttgcttcccag
ctgcacacccacttggcggggcgtggggtgaggacgattttggtgaggggaggcaaagag
ctggaggtggtacaggaagaccagcatttcagtacgcactaccagacaatccgagttctt
aggaaaatggtgaacattttgcctggtgacgtacttataacaaagtgtacttataacaca
gaagataggagcaagcctacagtgggtggttttggcatcatggaggaaatgtgtgtcaac
tacattcactactacccccgtacccagctggagctctgcaagagccacgttgaccaagga
tacctgcagaaatattttaacttcattaacaggttccacggaaatgaccagtgtgtgtgt
ggtgaggttagtgtgacggagcagttttctcaactagagtgggatgaattcaccggagaa
gtgctggactcgctttataacacagcccccatctcgatgcactgcaatcagtcgactgca
cgcctctttcctggtgactgggacaaacagcccataccagcggtgacctccgtccttgaa
aaacctcagtacacctgtaagcgaggcacgcttcgcaccaactga

DBGET integrated database retrieval system