KEGG   Maylandia zebra (zebra mbuna): 101464817Help
Entry
101464817         CDS       T02814                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mze00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 614 aa AA seqDB search
MRIFSKNLRLQDITIMYFTALAALMVILVASYQAPNNAVEVSSLKPNPSRPLPPLPMPFR
VPLDPRGELQLAWNVSYTNQEIYMELRVAELRHGVVLGMSDRGELTNADLLVLWDSGTQS
YFGDAWSDSKGHVSLDSQQDYDLIEAKQKAEGYYLLFKRPFSTCDPRDYVIEEGTVHIIY
GFLDKPLASLDKLNLSEIRTGVQRVLMLRPDTPPPTLPPDVQMLDVVAPNVIIPNQETTY
WCYIHNLPENLAKNHIVMYESAITPGNEAIVHHIEVFECSPDVPAVPGYSGSCDDKMKPK
KLNFCRHVLAAWAMGAEAFYYPPDAGLAMGGPGSSRFLRLEVHYHNPLLISGRRDSSGIR
LYYTPSLRRYDAGIMELGLVYTPVMAIPPKQHTFYLSGYCTSKCTQTALPSGGIYVFASQ
LHTHLAGRGVRTILVRGGKELEVVQEDQHFSTHYQTIRVLRKMVNILPGDVLITKCTYNT
EDRSKPTVGGFGIMEEMCVNYIHYYPRTQLELCKSHVDQGYLQKYFNFINRFHGNDQCVC
GEVSVTEQFSQLEWDEFTGEVLDSLYNTAPISMHCNQSTARLFPGDWDKQPIPAVTSVLE
KPQYTCKRGTLRTN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcttcagcaaaaaccttcgccttcaggacataaccatcatgtattttactgcc
ctggctgctctaatggtcatcttggtggcttcttaccaggcgcccaacaatgctgttgaa
gtgtccagccttaaaccgaacccctctcgccctctcccacctctccccatgcctttccgg
gtgccccttgatccacgtggggagctccagctggcttggaacgtcagctacaccaaccag
gagatttatatggagctgagggttgcagagctcagacacggggtggtcctggggatgtcc
gatcggggagagctgaccaatgctgacctgttggtactgtgggactctggaacccagagc
tactttggagatgcttggagtgacagcaagggtcatgtatcactagacagccaacaagac
tacgacctgattgaagccaaacagaaagctgaaggatattacctgctcttcaaaagacca
ttcagtacctgcgatcccagagactacgtcatagaggaggggactgtgcacatcatctac
ggcttcttggataaaccacttgcctcactggataagctgaacctgtccgagatccgcacc
ggcgtacagagagtcctgatgttgcgtcccgacacgccgccacctaccctgcctccagac
gtacaaatgttagatgtagtggcaccaaatgtcatcataccaaatcaagagaccacctac
tggtgctacatccacaacctgccggaaaatttggccaagaaccacattgttatgtacgag
tcggcgataactccagggaacgaggccatcgtgcatcacatagaagtgtttgagtgttct
ccggatgtccctgcagttccagggtacagcggctcctgtgatgacaaaatgaagccgaaa
aagctcaacttttgccgacacgtgctagctgcatgggctatgggggctgaggctttctac
tatccccctgatgcaggcttggctatgggtggaccaggttcctcaagattcctccgtctg
gaggtccattaccacaaccctctccttatatccggccggcgtgactcatcagggatacga
ctgtattacaccccgagcctgaggcgctacgatgcagggatcatggagctgggcctcgtt
tacactcctgtaatggctatcccacctaaacaacacaccttttacctcagtggatactgc
acctccaagtgtacccaaacagctttgccttcaggtggaatctatgtatttgcttcccag
ctgcacacccacttggcggggcgtggggtgaggacgattttggtgaggggaggcaaagag
ctggaggtggtacaggaagaccagcatttcagtacgcactaccagacaatccgagttctt
aggaaaatggtgaacattttgcctggtgacgtacttataacaaagtgtacttataacaca
gaagataggagcaagcctacagtgggtggttttggcatcatggaggaaatgtgtgtcaac
tacattcactactacccccgtacccagctggagctctgcaagagccacgttgaccaagga
tacctgcagaaatattttaacttcattaacaggttccacggaaatgaccagtgtgtgtgt
ggtgaggttagtgtgacggagcagttttctcaactagagtgggatgaattcaccggagaa
gtgctggactcgctttataacacagcccccatctcgatgcactgcaatcagtcgactgca
cgcctctttcctggtgactgggacaaacagcccataccagcggtgacctccgtccttgaa
aaacctcagtacacctgtaagcgaggcacgcttcgcaccaactga

DBGET integrated database retrieval system