KEGG   Maylandia zebra (zebra mbuna): 101465690Help
Entry
101465690         CDS       T02814                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101465690
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101465690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 472 aa AA seqDB search
METTRRRPQHSANGKRSEQKEQLAQWGRAWEVDWFSLISVIGLLCFAPFIVFYFVMACDQ
YECSITQPVLDLYQGEATLLSIWARAPSFSWSAAKIYAIWVSFQVFLYMCFPDITHKFIP
GYVGGVQEGARTPAGLINKYEINGLQCWLITHALWFANAHYFHWFSPTIIFDNWIPLLWC
TNILGYAVSTFAFIKAHLFPTNAEDCKFTGNIFYNYMMGIEFNPRIGKWFDFKLFFNGRP
GIVAWTLINLSYMAKQQELYGYITNSMILVNVLQAIYVLDFFWNEAWYLKTIDICHDHFG
WYLGWGDCVWLPYLYTLQGLYLVYHPVQLSDAHALAVLLLGLVGYYIFRSTNHQKDLFRR
TEGSCSIWGRKPTWIECTYRSADGGMHRSKLLTSGFWGVARHFNYTGDLMGSLAYCASCG
FGHILPYFYIVYMTILLVHRCVRDEHRCSSKYGKDWKRYTDAVPSRLIPGVF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccaggagacgaccgcagcacagtgccaatgggaaaagatctgaacagaag
gagcagctagcacagtgggggagagcgtgggaggtggactggttttccctcatcagtgta
atcggcctcctttgctttgcccctttcattgtcttctactttgtgatggcctgtgatcag
tatgagtgctccatcacccagcctgtgttggatctgtaccaaggagaggccaccctgctc
tccatttgggcccgggcaccctccttctcgtggtcagctgctaagatctatgccatctgg
gtgagcttccaggtgttcctgtacatgtgttttcctgatattacccacaagttcatccct
ggctatgttggtggtgtgcaggaaggagcacgaaccccagctggcctgattaacaagtat
gagatcaatggactgcagtgctggctcatcactcatgcactgtggtttgccaacgcacat
tatttccactggttttctcccacgatcatattcgacaactggatccccctgctgtggtgc
actaacatactgggctatgctgtgtccacgtttgctttcataaaagcgcatcttttcccc
accaacgctgaggactgcaagttcacagggaacatcttctataactacatgatgggtatt
gagttcaacccccgcataggcaagtggtttgacttcaagttattcttcaacggccggccc
ggcatcgtagcctggactctaatcaatctgtcctacatggccaagcaacaagaactctac
ggttacatcaccaactccatgatcctggtgaatgtactgcaggctatttatgtactggac
ttcttctggaatgaggcgtggtacctgaagaccatcgatatctgtcatgaccactttgga
tggtatctgggctggggagactgtgtttggctgccatacctctacacactgcagggtctg
tacctggtgtaccacccagtccagctctccgatgcccacgccctcgccgtcttgctgctc
ggccttgttgggtattacatctttcgctccaccaaccaccagaaggatctgttccgccgc
acagagggctcctgctccatctggggccgcaaaccaacatggattgagtgcacatatcgc
tccgccgatggcggcatgcaccgcagcaagctcctgacctcaggcttctggggcgtggcc
cggcacttcaactacaccggtgacctgatgggctctctggcctattgtgcctcgtgtggt
ttcggccacatacttccatatttctacattgtttacatgactatcttgctggtccaccgc
tgtgttcgcgatgaacaccgctgcagcagcaagtatggcaaagactggaaacggtacacc
gatgccgtgccttcccggctcattcctggagtgttttag

DBGET integrated database retrieval system