KEGG   Maylandia zebra (zebra mbuna): 101465732Help
Entry
101465732         CDS       T02814                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101465732
  Amino acid metabolism
   00350 Tyrosine metabolism
    101465732
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101465732
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101465732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 264 aa AA seqDB search
MWLTLFYSCTGGAALLYALYRWLIPTAVQYHGGLALLWHDMIVERMLDTLTQSTRPQRLL
HAVQKNATRGDPRSVVKAIDNFCRQKEWAMNVGDEKGCILDSVVSEVNPVTVLELGTYCG
YSTVRIASLLPPRAKIITLEFNPDYAKIARQVIAWAGLEDKIQVVEGPSGEWIPKMKEQF
GVKTFDLVFLDHWKDRYLPDTKLLEDCGLLRKGTILLADNVICPGTPDYLEYVRNSPRYK
SQYFKSHLEYTKAEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgactctattctacagctgcacaggtggagcagctcttctgtatgctctgtac
agatggctgattcccactgctgtgcagtatcatggaggactggcgctattgtggcacgac
atgattgtggagcgaatgctggacacactgacccagtccacacgtcctcagcgactccta
catgcagtacagaagaacgccactagaggagaccctcgcagcgtggtgaaagccatcgac
aacttctgcagacagaaggaatgggccatgaatgtcggggatgagaaaggctgcattctt
gattcagtggtgtctgaagtgaatccagtcactgtgttagagctgggaacctactgtggc
tactctacggtgcgcatcgccagccttcttcctccacgcgccaagatcatcactcttgaa
tttaacccagactacgccaaaattgctcgtcaggttattgcttgggcaggactagaggat
aagatccaggtagttgaaggcccatctggcgagtggatccccaaaatgaaggaacagttt
ggggtgaaaacatttgatttggttttcttggatcactggaaagatcgctaccttcctgac
acaaagctgctagaggactgtggcctcctaaggaaaggcactatcttgctggcagacaac
gtcatctgccctggaacccctgattaccttgagtatgttcgaaacagcccgagatacaaa
agccagtacttcaaatctcatctggagtacaccaaagcggaggatggcttggagaaatct
gtcttcttagggtag

DBGET integrated database retrieval system